KEGG   Xenopus tropicalis (western clawed frog): 733554Help
Entry
733554            CDS       T01011                                 

Gene name
ncoa3, actr, aib-1, aib1, bHLHe42, cagh16, ctg26, kat13b, pcip, rac3, src-1, src-3, src3, tnrc14, tnrc16, tram-1, xSRC-3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 1342 aa AA seqDB search
MSGLGENSLDPLAAETRKRKPSSCDTPGPGLTCSGEKRRREQESKYIEELAELISANLSD
IDNFNVKPDKCAILKETVRQIRQIKEQGKASSNDDDVQKADVSSTGQGVIDKDSLGPLLL
QALDGFLFVVNREGSIVFVSENVTQYLQYKQEDLVNTSVYSILHEEDRKDFLKNLPKSTV
NGVPWSSETPRQKSHTFNCRMLVKTSHDHLEDGSGNLDTRQRYETMQCFALSQPRAMIEE
GEDLQSCMICVARRITTVERVFSANPESFITRHDLTGKVVNIDANSLRSSMRPGFEDTIR
RCIQRFLCHSDGQPWTYKRHYQEAYVHGHSETPLYRFSLADGTIVTAQTKSKLFRIPVTN
DPHGFVSTHFLQREQNGYRPNPNPMAQNIRPPVNPNPPNTMNAMPPQAMQQQNRNYGMGD
PNSMAQMPGMRYKSPGNMAPVNQPPGVQQSPYQNNSNYGLNMNSPPHGSPGMNSNQPNLM
VSPRNRASPKMASNQFSPVPGMNSPMGSSGSAGGGSFSSSSLSALHAISEGVGSSLLSSL
SSPGQKVENNTNMNMPQQGKIGNQDCKSPSGLYCEQGQVESSVCQSSGREHLGEKDVKEN
ILEASDSQRSQAESKGHKKLLQLLTGSSEDRGPSLMSSSSIDCKDSSTNVTSPSGVSSST
STGVSSTSNLHGSMLQEKHRILHKLLQNGNSPAEVAKITAEATGKDSFQETVSSAPCTEA
TVKREQLSPKKKENNALLRHLLDKDDWKDPLSKDIKPKVEHMDAKMGPCSSSSVPTSSQD
KEVKIKTEPADEVPGDLDNLDAILGDLAGSDFYNNSMSSRASDHGPKQPVFQDSPTLESL
SPVVLSCAGSGPNRSMNQHPGGEWAMQNAAVNRLEPPNAGNVGRPGPDYSTAMPRPAMGG
NMPGLPARSNSIPGSRPVLQQQMLPMRPNEMAMGMGSNPYGQQAPSNPPGSWPDGMMIDQ
GHGGTQARQLGRNSLDDLLCPPSTVEGQTDEIALLDQLHTLLSNTDATGLEEIDRALGIP
DLVSQGQALEPQQDSYQPQGSPVMIDQKPPMYGQPYAGQGTAMAAAGFNAMQGQHPPFNS
VMGQMNQQQGNFPLQGMHPRANLMRPRNNIPKQLRMQLQQRLQGQQFLNQNRQALEMKVE
TMNPGGAGVMRPVMQTPVSQQGFLNAQMVAQRNRELISHQIRQHRMAMMMQQQQQGQPQT
FSPPPNVTATASMDNPLGGPPMPQAPPQQFSYPPNYGMNQQADPTFGRVSSPPNAIMSSR
MAPSQNPHPQTAQMYPSPDMKGWPSGNMTRPNSFPQQQYSHQANPATYNMMHMNGNGSHM
GQINMNSMPMSGMPMGPDQKYC
NT seq 4029 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaggggaaaactccttggatccgctggcagcagaaacaagaaagcgcaag
ccatcttcctgcgatactcccgggcctgggctgacctgcagtggtgagaagagaagacgt
gagcaggagagcaagtacatcgaggagttggccgagctcatttcagccaatcttagcgac
atagacaatttcaatgtcaaaccggacaaatgcgcaatcttaaaggagacagttaggcag
atccgtcagattaaagagcaaggaaaagcctcttctaatgatgacgatgtgcagaaagct
gatgtgtcttctacagggcagggggtaattgataaggattctctcggcccactcttattg
caggcactggacggcttcctgtttgtggtgaatcgagagggcagcattgtatttgtctct
gaaaatgtcacccagtatttacaatacaaacaagaggatctggttaacactagtgtctac
agcatcctgcacgaagaggaccgtaaagatttccttaagaacctgcccaaatctactgtt
aatggcgtcccatggtccagcgaaacccctcgacagaagagccacacattcaactgtcgc
atgctggtcaagacctctcatgatcatctggaggatgggagtggcaacctggacacacgt
cagcgatatgagaccatgcagtgctttgccttatctcagccccgggcgatgatcgaggag
ggagaagaccttcagtcctgtatgatctgtgtggccaggcgcatcacaactgtagagagg
gtcttctccgccaatcctgaaagcttcattacaaggcacgatctgacaggtaaggtggta
aacatagacgccaactccctacgttcctccatgagaccaggctttgaggacaccatccga
agatgtattcagaggttcctgtgtcacagcgacgggcagccatggacgtacaaacgccat
taccaagaagcctatgtccacgggcattctgaaacacctctgtataggttctcactggcc
gatggcaccatagtgactgctcagacaaaaagtaagctctttcgtattcctgtcaccaat
gatccacacggcttcgtctccacgcacttcttgcaaagggaacagaatggctacagaccc
aatccgaacccaatggcacaaaatattcggccaccagtgaaccccaatcctcccaataca
atgaatgcaatgccgcctcaggccatgcagcagcagaacaggaactatggcatgggggat
cccaacagcatggcacaaatgccaggcatgcgatacaagtccccaggcaacatggcgcct
gttaatcaacctccaggggtacagcagtctccgtaccaaaacaatagtaattatggcctt
aacatgaatagcccaccccatggcagtccaggcatgaattctaaccaacccaaccttatg
gtgtcacccagaaaccgggctagccccaagatggcatccaatcagttttctcctgttcca
ggcatgaactctccaatgggatcttcaggaagtgcagggggaggaagcttctccagcagc
tctctaagcgctctccacgccataagtgaaggagtggggagctcactcctgtcatccttg
tcttctcctggccagaaagtagagaacaataccaatatgaacatgccccagcagggtaaa
attggcaaccaggattgcaagagcccaagtggattgtactgtgaacaaggacaagtggaa
agctctgtgtgtcagtcaagtggtagggagcaccttggggaaaaggacgttaaagagaac
atacttgaagcgtcagacagtcagagatcacaagctgaaagtaaagggcataagaaactt
ctccagcttctcacaggttcttcagaagataggggtccaagtcttatgtccagttcttct
atagactgcaaagattcatccaccaatgtaactagtccctccggagtgtcctcatccacc
tccactggggttagctccacgtccaacttgcatgggtctatgcttcaagaaaaacaccgc
attctccataagttgctccaaaatggcaattcccccgccgaggtagcaaagatcacagca
gaagccaccggaaaggacagttttcaggagacggtgagctctgcaccatgcacagaagca
acggtgaaacgagagcagctgagcccaaagaagaaggaaaacaatgcacttctgaggcat
ttgctggacaaagacgactggaaggacccactgtcgaaggacattaaacccaaagtggaa
cacatggatgctaaaatgggcccgtgtagcagctccagtgttcccacttcaagtcaggat
aaagaggttaaaataaagacagagcctgcagatgaggttcccggagatttggataatttg
gatgccatcctgggggatttggctggttctgacttctacaacaattcaatgagttctaga
gcaagtgaccatgggcccaagcagcctgtattccaggacagcccaacattggaatcactc
agccctgttgtactttcttgtgcaggaagtggacccaacaggagtatgaaccagcatcca
ggtggggagtgggctatgcagaacgcagcagtcaataggttggagcctcctaatgcagga
aacgtgggccgacctgggccagattacagcacagcaatgccaaggcctgcgatgggcggg
aacatgccgggacttccagccaggtctaacagtattcctgggagcagaccggtgctgcag
caacagatgcttccaatgaggcccaatgagatggcaatgggcatgggatcaaatccttat
ggacaacaggccccttcaaatccgccgggatcgtggcctgatggcatgatgatagaccag
ggtcatggtggcactcaggccagacagttagggaggaattcgttggacgacctcttgtgt
cctccttcaaccgtcgaagggcagacagatgaaattgccctccttgatcaattgcacacc
cttctcagcaacacagatgccacaggactggaagaaatagaccgagctctgggaattccg
gacttggtcagtcagggtcaagctttggagccacagcaagattcttaccagcctcaaggt
tctccagtcatgatcgatcaaaagccacccatgtatgggcagccctacgcagggcaggga
acagcaatggctgctgccggatttaatgccatgcaggggcagcacccacccttcaattca
gtgatgggtcagatgaaccagcagcaaggcaatttcccactgcaaggtatgcacccacgg
gccaacctcatgagaccccgaaacaacatacccaaacaactgagaatgcaacttcagcag
aggcttcaggggcagcagtttctgaaccaaaatcgacaagccttagagatgaaggtggag
acaatgaatcccggcggagctggagttatgagacccgtaatgcagacgccggtctctcag
cagggctttctcaatgcccagatggtggcccagaggaacagggagctgattagccaccaa
atcagacagcacagaatggccatgatgatgcaacagcagcagcaaggccaaccccagacc
ttcagccctcctcccaatgtgactgccacagccagtatggataacccactaggagggcca
ccaatgccccaggcccctcctcagcaattctcctaccctcctaattatggtatgaatcaa
caggcggatcccacttttggaagggtgtccagcccacctaatgccataatgtcatctcgg
atggctccttcccagaatcctcaccctcaaaccgcccaaatgtatccatcaccagacatg
aaaggctggccatcagggaatatgactagaccaaattccttcccacagcagcagtacagc
caccaggccaaccccgccacgtataacatgatgcacatgaatgggaatgggagccacatg
gggcagatcaacatgaactccatgcctatgtctgggatgcctatgggacctgatcagaaa
tattgctga

DBGET integrated database retrieval system