KEGG   Xenopus tropicalis (western clawed frog): 733554Help
Entry
733554            CDS       T01011                                 

Gene name
ncoa3, actr, aib-1, aib1, bHLHe42, cagh16, ctg26, kat13b, pcip, rac3, src-1, src-3, src3, tnrc14, tnrc16, tram-1, xSRC-3
Definition
(RefSeq) nuclear receptor coactivator 3
  KO
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     733554 (ncoa3)
Chromosome [BR:xtr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    733554 (ncoa3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
Position
10
AA seq 1378 aa AA seqDB search
MSGLGENSLDPLAAETRKRKPSSCDTPGPGLTCSGEKRRREQESKYIEELAELISANLSD
IDNFNVKPDKCAILKETVRQIRQIKEQGKASSNDDDVQKADVSSTGQGVIDKDSLGPLLL
QALDGFLFVVNREGSIVFVSENVTQYLQYKQEDLVNTSVYSILHEEDRKDFLKNLPKSTV
NGVPWSSETPRQKSHTFNCRMLVKTSHDHLEDGSGNLDTRQRYETMQCFALSQPRAMIEE
GEDLQSCMICVARRITTVERVFSANPESFITRHDLTGKVVNIDANSLRSSMRPGFEDTIR
RCIQRFLCHSDGQPWTYKRHYQEAYVHGHSETPLYRFSLADGTIVTAQTKSKLFRIPVTN
DPHGFVSTHFLQREQNGYRPNPNPMAQNIRPPVNPNPPNTMNAMPPQAMQQQNRNYGMGD
PNSMAQMPGMRYKSPGNMAPVNQPPGVQQSPYQNNSNYGLNMNSPPHGSPGMNSNQPNLM
VSPRNRASPKMASNQFSPVPGMNSPMGSSGSAGGGSFSSSSLSALHAISEGVGSSLLSSL
SSPGQKVENNTNMNMPQQGKIGNQDCKSPSGLYCEQGQVESSVCQSSGREHLGEKDVKEN
ILEASDSQRSQAESKGHKKLLQLLTGSSEDRGPSLMSSSSIDCKDSSTNVTSPSGVSSST
STGVSSTSNLHGSMLQEKHRILHKLLQNGNSPAEVAKITAEATGKDSFQETVSSAPCTEA
TVKREQLSPKKKENNALLRHLLDKDDWKDPLSKDIKPKVEHMDAKMGPCSSSSVPTSSQD
KEVKIKTEPADEVPGDLDNLDAILGDLAGSDFYNNSMSSRASDHGPKQPVFQDSPTLGRN
XFSVYLDLYFVXPKVSQVIYLDRPDSTNGSXSLESLSPVVLSCAGSGPNRSMNQHPGGEW
AMQNAAVNRLEPPNAGNVGRPGPDYSTAMPRPAMGGNMPGLPARSNSIPGSRPVLQQQML
PMRPNEMAMGMGSNPYGQQAPSNPPGSWPDGMMIDQGHGGTQARQLGRNSLDDLLCPPST
VEGQTDEIALLDQLHTLLSNTDATGLEEIDRALGIPDLVSQGQALEPQQDSYQPQGSPVM
IDQKPPMYGQPYAGQGTAMAAAGFNAMQGQHPPFNSVMGQMNQQQGNFPLQGMHPRANLM
RPRNNIPKQLRMQLQQRLQGQQFLNQNRQALEMKVETMNPGGAGVMRPVMQTPVSQQGFL
NAQMVAQRNRELISHQIRQHRMAMMMQQQQQGQPQTFSPPPNVTATASMDNPLGGPPMPQ
APPQQFSYPPNYGMNQQADPTFGRVSSPPNAIMSSRMAPSQNPHPQTAQMYPSPDMKGWP
SGNMTRPNSFPQQQYSHQANPATYNMMHMNGNGSHMGQINMNSMPMSGMPMGPDQKYC
NT seq 4137 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaggggaaaactccttggatccgctggcagcagaaacaagaaagcgcaag
ccatcttcctgcgatactcccgggcctgggctgacctgcagtggtgagaagagaagacgt
gagcaggagagcaagtacatcgaggagttggccgagctcatttcagccaatcttagcgac
atagacaatttcaatgtcaaaccggacaaatgcgcaatcttaaaggagacagttaggcag
atccgtcagattaaagagcaaggaaaagcctcttctaatgatgacgatgtgcagaaagct
gatgtgtcttctacagggcagggggtaattgataaggattctctcggcccactcttattg
caggcactggacggcttcctgtttgtggtgaatcgagagggcagcattgtatttgtctct
gaaaatgtcacccagtatttacaatacaaacaagaggatctggttaacactagtgtctac
agcatcctgcacgaagaggaccgtaaagatttccttaagaacctgcccaaatctactgtt
aatggcgtcccatggtccagcgaaacccctcgacagaagagccacacattcaactgtcgc
atgctggtcaagacctctcatgatcatctggaggatgggagtggcaacctggacacacgt
cagcgatatgagaccatgcagtgctttgccttatctcagccccgggcgatgatcgaggag
ggagaagaccttcagtcctgtatgatctgtgtggccaggcgcatcacaactgtagagagg
gtcttctccgccaatcctgaaagcttcattacaaggcacgatctgacaggtaaggtggta
aacatagacgccaactccctacgttcctccatgagaccaggctttgaggacaccatccga
agatgtattcagaggttcctgtgtcacagcgacgggcagccatggacgtacaaacgccat
taccaagaagcctatgtccacgggcattctgaaacacctctgtataggttctcactggcc
gatggcaccatagtgactgctcagacaaaaagtaagctctttcgtattcctgtcaccaat
gatccacacggcttcgtctccacgcacttcttgcaaagggaacagaatggctacagaccc
aatccgaacccaatggcacaaaatattcggccaccagtgaaccccaatcctcccaataca
atgaatgcaatgccgcctcaggccatgcagcagcagaacaggaactatggcatgggggat
cccaacagcatggcacaaatgccaggcatgcgatacaagtccccaggcaacatggcgcct
gttaatcaacctccaggggtacagcagtctccgtaccaaaacaatagtaattatggcctt
aacatgaatagcccaccccatggcagtccaggcatgaattctaaccaacccaaccttatg
gtgtcacccagaaaccgggctagccccaagatggcatccaatcagttttctcctgttcca
ggcatgaactctccaatgggatcttcaggaagtgcagggggaggaagcttctccagcagc
tctctaagcgctctccacgccataagtgaaggagtggggagctcactcctgtcatccttg
tcttctcctggccagaaagtagagaacaataccaatatgaacatgccccagcagggtaaa
attggcaaccaggattgcaagagcccaagtggattgtactgtgaacaaggacaagtggaa
agctctgtgtgtcagtcaagtggtagggagcaccttggggaaaaggacgttaaagagaac
atacttgaagcgtcagacagtcagagatcacaagctgaaagtaaagggcataagaaactt
ctccagcttctcacaggttcttcagaagataggggtccaagtcttatgtccagttcttct
atagactgcaaagattcatccaccaatgtaactagtccctccggagtgtcctcatccacc
tccactggggttagctccacgtccaacttgcatgggtctatgcttcaagaaaaacaccgc
attctccataagttgctccaaaatggcaattcccccgccgaggtagcaaagatcacagca
gaagccaccggaaaggacagttttcaggagacggtgagctctgcaccatgcacagaagca
acggtgaaacgagagcagctgagcccaaagaagaaggaaaacaatgcacttctgaggcat
ttgctggacaaagacgactggaaggacccactgtcgaaggacattaaacccaaagtggaa
cacatggatgctaaaatgggcccgtgtagcagctccagtgttcccacttcaagtcaggat
aaagaggttaaaataaagacagagcctgcagatgaggttcccggagatttggataatttg
gatgccatcctgggggatttggctggttctgacttctacaacaattcaatgagttctaga
gcaagtgaccatgggcccaagcagcctgtattccaggacagcccaacattgggtaggaat
tgattttcagtttatttggacctatattttgtgtagcccaaagtttcacaagtaatttat
ctcgatcggccagattccacaaatggttcctgatctctagaatcactcagccctgttgta
ctttcttgtgcaggaagtggacccaacaggagtatgaaccagcatccaggtggggagtgg
gctatgcagaacgcagcagtcaataggttggagcctcctaatgcaggaaacgtgggccga
cctgggccagattacagcacagcaatgccaaggcctgcgatgggcgggaacatgccggga
cttccagccaggtctaacagtattcctgggagcagaccggtgctgcagcaacagatgctt
ccaatgaggcccaatgagatggcaatgggcatgggatcaaatccttatggacaacaggcc
ccttcaaatccgccgggatcgtggcctgatggcatgatgatagaccagggtcatggtggc
actcaggccagacagttagggaggaattcgttggacgacctcttgtgtcctccttcaacc
gtcgaagggcagacagatgaaattgccctccttgatcaattgcacacccttctcagcaac
acagatgccacaggactggaagaaatagaccgagctctgggaattccggacttggtcagt
cagggtcaagctttggagccacagcaagattcttaccagcctcaaggttctccagtcatg
atcgatcaaaagccacccatgtatgggcagccctacgcagggcagggaacagcaatggct
gctgccggatttaatgccatgcaggggcagcacccacccttcaattcagtgatgggtcag
atgaaccagcagcaaggcaatttcccactgcaaggtatgcacccacgggccaacctcatg
agaccccgaaacaacatacccaaacaactgagaatgcaacttcagcagaggcttcagggg
cagcagtttctgaaccaaaatcgacaagccttagagatgaaggtggagacaatgaatccc
ggcggagctggagttatgagacccgtaatgcagacgccggtctctcagcagggctttctc
aatgcccagatggtggcccagaggaacagggagctgattagccaccaaatcagacagcac
agaatggccatgatgatgcaacagcagcagcaaggccaaccccagaccttcagccctcct
cccaatgtgactgccacagccagtatggataacccactaggagggccaccaatgccccag
gcccctcctcagcaattctcctaccctcctaattatggtatgaatcaacaggcggatccc
acttttggaagggtgtccagcccacctaatgccataatgtcatctcggatggctccttcc
cagaatcctcaccctcaaaccgcccaaatgtatccatcaccagacatgaaaggctggcca
tcagggaatatgactagaccaaattccttcccacagcagcagtacagccaccaggccaac
cccgccacgtataacatgatgcacatgaatgggaatgggagccacatggggcagatcaac
atgaactccatgcctatgtctgggatgcctatgggacctgatcagaaatattgctga

DBGET integrated database retrieval system