KEGG   Xenopus tropicalis (western clawed frog): 733718Help
Entry
733718            CDS       T01011                                 

Gene name
pak2, pak65, pakgamma
Definition
p21 protein (Cdc42/Rac)-activated kinase 2
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Focal adhesion
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    733718 (pak2)
   04012 ErbB signaling pathway
    733718 (pak2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    733718 (pak2)
  Cell communication
   04510 Focal adhesion
    733718 (pak2)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     733718 (pak2)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   733718 (pak2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 518 aa AA seqDB search
MSDNGELEDKPPAPPARISSTGTKDPLTSNHSHKPLPLIPEKPRNKIISMFSGTEKGSRK
KERERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDV
LKFYDSKHTDKQKYLSFSAPDKDGLPSGVSSAPNAKGSEPSTAATDDDSDDDKAPPPVIA
PRPEHTKSMYTRSVIDPIPPPPGDSDSAAKAGDRQKKKTKMSDEEIMEKLRTIVSIGDPK
KKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNI
VNFLDSFLVSDELYVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIH
RDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDI
WSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQKPEKLSPIFRDFLNRSLEMDVE
KRGSARELLQHPFLKLAKPLSSLTPLILAAKEAMKGNR
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggggagcttgaagataagccgccagctcctccagctcggattagcagc
acagggacaaaagatcctctgaccagcaaccacagtcataaacctttacctttaatccct
gaaaaacccaggaataaaattatttcaatgttttctggcacagaaaaaggaagcagaaaa
aaagaaagggaaaggccagagatttcaccaccgtcagattttgagcacactattcatgtg
ggctttgatgctgtcactggagaattcactggaatgccagagcaatgggcacggttactg
cagacctcaaacattactaaactcgaacagaagaaaaatccacaagctgtcctggatgtt
ttaaagttttatgactccaaacacacagacaagcagaaatatctaagcttctctgcacca
gataaagatgggcttccctctggtgtttcctctgcacctaatgcaaaaggctctgaacct
tcaacagcagcaacagatgatgatagcgatgatgataaggctcctcctcctgttattgct
ccaaggccagaacacaccaaatcaatgtatacacggtctgtaattgacccaatacctcca
ccccctggagattcagacagtgctgcaaaggctggagaccggcagaaaaagaaaacaaag
atgagcgatgaagagattatggaaaaacttagaactatagtaagcataggagaccccaag
aaaaaatatactagatatgaaaaaattggacaaggggcctctggaactgtatttactgct
attgatgtagctaccggacaggaggttgcaatcaaacagataaatcttcagaagcagccc
aagaaagaactgataatcaatgagattctagtgatgaaagaattgaagaaccccaatata
gtaaatttcctggacagtttcttggtgagtgacgagctgtatgttgtaatggagtatttg
gctggaggatcccttacagacgtagtcacagaaacctgtatggatgaggcacagatagca
gctgtctgcagagagtgtctgcaagctttggaattcctacatgcgaaccaggtcattcac
agagacataaagagtgacaatgttctccttggaatggatggttctgtcaaactgaccgac
tttggcttctgtgcacaaattaccccagaacagagcaagcgaagcaccatggtgggaaca
ccatactggatggcaccagaagtggttacaaggaaagcatatggccccaaggtggatatc
tggtcacttggaattatggctattgaaatggtggaaggggaaccaccttatctcaacgaa
aatcctttaagggctttgtatttgattgctactaatggaactccggaacttcagaaacct
gaaaaactttcaccgatattccgggatttcttaaaccgctcacttgagatggatgtagaa
aagagagggtccgctagagagctcttacagcacccattcctgaaactcgcaaaaccactg
tccagcctcacaccgctaatcctggctgccaaagaagcgatgaagggaaaccgctaa

DBGET integrated database retrieval system