KEGG   Xenopus tropicalis (western clawed frog): 734023Help
Entry
734023            CDS       T01011                                 

Gene name
ep300, p300
Definition
E1A binding protein p300
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    734023 (ep300)
   04330 Notch signaling pathway
    734023 (ep300)
   04350 TGF-beta signaling pathway
    734023 (ep300)
   04630 Jak-STAT signaling pathway
    734023 (ep300)
   04068 FoxO signaling pathway
    734023 (ep300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    734023 (ep300)
  Cell communication
   04520 Adherens junction
    734023 (ep300)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    734023 (ep300)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    734023 (ep300)
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     734023 (ep300)
Transcription factors [BR:xtr03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    734023 (ep300)
Mitochondrial biogenesis [BR:xtr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    734023 (ep300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 2475 aa AA seqDB search
MAENLVDPGPPSAKKPKMSSPSLSSSDVPDFGSLFDLEQDLPDELINSSEFGLTNGGDLS
QLHNSMNMVPDAAAKHKQLSELLRGGTTSNMSMGLGQQTSQNSPGINLLNSMVKSPMNQG
GLTSPNMGMGGSGNTGPTAQQINPTSAAGMIPGVNSPVNQHGMGINAGMMTAGNGQSMIQ
GQMMNGSVGSGRGRPNMQYPNPNMGNTGNILAETLQGGPQIGGQPGMRGPQPTAMNKMGL
MNNPNPYGTPYGQNVVPQMGGAVMGSQIQNKAALQNSLSQFPMDKKPGVGMPNMNQQTST
QVQQTGMVTAAPPSMGAGAPQGIGSGAPTADPEKRKLIQQQLVLLLHAHKCQRREQANGE
VRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNA
GDKRNQTLLGGPPVTLGAPGAVGTVGQQPAPSINATSQIDPSSIERAYAALGLPYQGNQM
QTQTQAQVKGQQSGQSPQAMRSLNTMNSSTMGVNGGVGVQASSLLPDSMLHSGMNAQSPM
MNESGGVPNLGSMPTAAPPSSSGIRKPWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDR
RMENLVAYARKVEGDMYESANSRAEYYHFLAEKIYKIQKELEEKRRTRLQKQHLIPTPPG
MPPTQMNQNQGMAQPQTGLSTNGPLPDPNSMMRANVPNQIMNRMQTQTGMNQFGQMGMQM
QSMGQRQQAPLQHPGQMGQTGPMNQMGFQARMQQPGTMQQTAQNQFLSQNQFQASSPVMN
TGGMNTGGLNASGMPMPQPGNQNPSSQAPMPNPSHPVSSPVMPPGAAGNQMHCSSHVQPM
HRNSPSPAPSRTPTPHHTPPGLTPQPTQTPVQPILPTAAPISQAPLQHRESPTPPQVTPS
LSIPTPVMSTADQQIATPPSQQPSQQFSSQQQPLPRPPSQPSLTTPVATPTAPPLPMQLQ
PSTPPTANLDCPSSNPPSTNSPEVSSQPPVQEPPPQEVKMEIKQEDDDLEPEPMEPPAEE
KPEVKAEVAVEECKSEPAELEEKKEEVKTEIKEEDEKPATPAAQTSPAPPGQSKKKIFKP
EELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFEIVKTPMDLSTIKRKLDTGQY
QEPWQYVEDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFS
PQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGECVSLGDDPTQPQTTISKDQF
SKRKNDTLDPEQYVECLECGRKMHQICVLHNETIWPTGFVCEGCLKKTGRNRKENKFSAK
RLPTTRLGSFLENRVNDFLRRQNNPEAGEVIIRVVHASDKTVEVKPGMKAKFVDTGEMAE
SFPYRTKALFAFEEVDGVELCFFGMHVQEYGSDCPQPNQRRVYISYLDSVHFFRPKNLRT
AVYHEILIGYLEYVKRLGYTAGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKML
DKSVSERVIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREE
NTSNESIEVGKGDSKNAKKKNNKKTSKNKSSLSRGSKKKPGMPNVSNDLSQKLYATMEKH
KEVFFVIRLSAGPAANSLPPIVEPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAKWST
MCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKTHEHKMEKLGLG
LDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGC
KRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRR
MASMQRAGGVGPQQGLPSPNSAGPATPTGQQPPTPQTPQPPPQPPTQQQPPPPNMPPYSM
ARAEPARGISQGKAAGQMTPPTPPQAGAMQQQVQGPPPAAVEMAMQIQRAAETQRQMAKA
QIFPRPMMNPHQMQPMNPMQPMGMNPQQGPRGQVHMESGIGPGMQQPQQQQQPPPTQPQP
PWVQSGLPQSQSMQPGMQRSPIMSVPQQGQPMNMNPQSGIGQVPGASQTKQGSLPQAALQ
NLLRTLRSPSSPMQQQQVLNILHSNPQLLAAFIKQRAAKYASSQNAQAAGNVPGMPAQAG
LQQVVHSNPGMQGMNPMQAIGPRPGMPQQPQAPQQQPPQQSPLPQQAMAGINPQGQPLNI
NPGGISPQFREIILRRQQIMQQQQQQQQQQQQQQQQQQQQQQQGAGPGMVNHNQFQQHQV
MSGYTQQQQQQQRFQHHIQMQQGSMGQMSQMPQGMPGDTSSGLQTFPQRLLHQQMGSPAQ
QNPMSPQQHMLPGPAQSPHLQGQQLPPSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQ
PSPHHVSPQTSSPHPGLVGPGQGNPMDQGHYGSPDPTAMLSQMAGLHGGGVQDLGLGADN
SDLNPNLSQSTLDIH
NT seq 7428 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaatttagtggatcctgggcccccttcggccaagaagcccaagatgtcttct
ccttccctgtcttccagtgatgttccagattttgggtctctgttcgacttggaacaggat
ttaccggatgagttgattaactcaagtgagtttggtctgactaatggtggagatctcagt
cagctacacaacagcatgaatatggtgcctgatgcagctgccaagcataagcagctttct
gagctcttgcgtggtggaaccacctcaaacatgagcatgggccttgggcaacaaacatca
caaaacagcccaggaataaacctactgaacagcatggtcaaaagtcccatgaaccaagga
ggacttacatcgccaaacatgggtatgggaggcagtggaaacactggaccaacagctcag
cagataaatcccacgtcagcagcaggaatgatacctggtgtgaatagccctgtaaaccag
catggcatgggcatcaacgcaggaatgatgacagctggaaatggacaaagtatgattcag
ggtcaaatgatgaatgggtctgttggatctggtagaggtcgtcctaacatgcagtacccc
aaccctaacatgggcaatacaggcaacattcttgccgaaacacttcaaggtggacctcaa
attggaggacagcctggtatgagaggtccacagccaacagccatgaacaagatgggtcta
atgaacaatcctaatccttatgggacaccttatggacaaaatgttgttccccagatgggg
ggcgcagttatgggatcacaaatccagaacaaggcagcattacagaatagcctgtctcag
tttccaatggacaagaaacctggagttggcatgccaaatatgaatcagcagacatccacc
caagttcagcaaactggaatggttactgcagctccgccgagtatgggagcaggtgcccct
cagggcattggctcaggggccccaacagcagatccagagaaaaggaagttgatccagcaa
caactggttcttcttctgcatgctcacaaatgtcagcgacgagaacaggccaatggagag
gtacggcaatgtaatttaccacattgccgaacaatgaagaatgtcctaaatcacatgaca
cactgccaagcgggcaaatcatgccaagttgcacattgtgcctcctcacgacaaataatt
tctcactggaaaaattgcacacgacatgattgtcctgtctgtctgcctctgaagaatgca
ggcgacaaacgtaatcaaactttgctgggtggtccaccagtgacgctgggagctcccggt
gctgtcggcacagttggccagcaacctgctccttcaattaatgccactagccaaattgac
ccaagctcaatagagagagcatatgcagctcttggtcttccgtaccagggtaatcaaatg
cagacacaaacacaagctcaagttaaaggccagcagtcgggacagtcaccacaggcaatg
cgttctctcaacacaatgaattcaagcacaatgggagtcaatggaggagtaggtgtacaa
gcttccagtttgcttcctgactccatgttgcattcaggaatgaacgctcagagtccaatg
atgaatgagagtggtggcgttcctaacctaggctctatgcctacggcagcaccaccctct
agttctggaatccgcaaaccttggcatgaagatatcacccaggatctgaggaaccatcta
gttcacaaacttgttcaagccatattcccaacacctgatccagcagcattaaaggatcgg
cgaatggagaacttggtagcttatgctcgcaaagttgaaggtgacatgtatgaatctgct
aatagcagggctgagtactaccactttctggctgagaaaatatacaagattcaaaaagaa
ttggaggaaaagcgtcgcaccagattgcaaaagcaacatctaattcccactcctcctggc
atgcctcctacacaaatgaatcaaaaccaaggaatggcccagccacaaactggattgtca
accaatggtcctttgccagatccaaacagcatgatgcgggctaatgtgccaaatcaaata
atgaatcgcatgcagacacaaactggaatgaaccaatttggacagatgggtatgcaaatg
cagtcaatgggccagagacagcaggctccacttcagcacccagggcaaatgggacaaacg
ggccctatgaaccagatgggatttcaggcccgtatgcagcagcctgggactatgcaacaa
acagcacagaaccagtttctgtcccaaaatcagtttcaggcatcttctcctgtgatgaac
actggaggaatgaataccggtggcttgaatgcatctggcatgcccatgccccagcctggc
aatcagaacccttcatctcaggcaccaatgcctaaccctagccatcctgtgagttctcca
gtgatgcccccgggagcagcagggaatcagatgcactgttcaagtcacgtccaacccatg
caccgcaactcaccgtcccctgctccaagccgtacaccaacccctcaccatacgcctcca
ggccttactccacaaccaactcagacacctgtacagcctatcctacccacagcagcacca
atttcacaagcaccactacaacacagagaaagccctactccaccacaagtgaccccttcc
ttatccatccctaccccggtaatgtctaccgctgaccagcagattgctacaccaccttct
cagcagccttcgcagcagttttcatcacagcaacagccattaccacggcccccttcacag
ccaagtttaacaacacctgtagccacgccaactgcaccaccactgccaatgcagcttcaa
ccgagcactccgcctacagccaacctggattgcccatcttccaatcctccctctacgaat
agtcctgaagttagctctcagccacctgttcaagagccaccacctcaagaggttaaaatg
gagataaagcaagaagatgatgatcttgagcctgagcctatggaacctccagcagaggag
aaaccagaggttaaagcagaggtagcagttgaggaatgcaaatctgagccagctgagctg
gaagagaagaaagaagaagttaaaacagaaatcaaggaggaagatgagaaaccagcaacc
cctgctgctcagacatctcctgctcctcctgggcagtccaagaagaagattttcaaacca
gaagaacttcggcaggctcttatgcccactctggaagcattataccgccaggatccagag
tctcttccgtttcgtcaaccagtggatcctcagttattaggaatcccggattactttgag
attgtcaagactcccatggacctttcgactattaaacgcaagttggacacaggacagtac
caagaaccctggcagtatgtggaagatatctggctgatgttcaacaatgcctggctatat
aaccgcaagacctctcgtgtctacaagtactgttccaagctggctgaggtgtttgagcag
gagatagatccagtcatgcaaagcttgggatactgctgtggtaggaagctggagttctcg
cctcagaccctttgctgttatgggaagcagctctgtacaattccccgtgatgccacttac
tacagctatcaaaacaggtaccacttctgtgaaaagtgcttcaacgagatccagggggag
tgcgtctctcttggtgatgatcccacccaacctcaaacaaccatcagcaaagatcaattc
tccaaaaggaaaaatgacacactggatccagaacaatacgtggagtgcttggagtgcggt
agaaaaatgcaccagatctgcgtgttacataatgaaaccatctggcccacgggctttgta
tgtgaaggctgtctaaagaaaacaggtcgaaatcggaaagagaacaaattttctgccaaa
cgtctcccaactacaaggcttggctcttttctggagaacagagtcaatgattttctgaga
agacagaataatcctgaggctggagaggtgattattcgggtggtccatgcatctgacaaa
acagtggaagtgaaacctggcatgaaagcgaagtttgtggatactggagagatggcagaa
tccttcccataccgaacaaaagccttatttgcttttgaagaggttgatggagttgaactg
tgtttttttggaatgcacgtgcaagaatatggctctgactgtccccagcccaatcaaagg
cgggtttatatttcctatctggacagtgtacatttctttcggccaaagaaccttagaaca
gctgtgtatcatgaaattctcattggctatctggagtatgtcaagagactagggtataca
gcagggcacatatgggcctgtccaccaagtgagggcgatgactatatatttcattgtcac
ccagcggaccagaagatcccaaagcccaagcgcttgcaagagtggtacaagaagatgcta
gataagtctgtttctgagcgggttatacatgattacaaggacatctttaagcaggcaaca
gaagaccgactgaccagtgccaaggagctgccatactttgaaggggatttctggcctaat
gtgctggaagagagcattaaggaactggagcaggaggaggaagaaaggaagcgagaagaa
aataccagcaatgagagtattgaggttgggaaaggagacagtaaaaatgcaaaaaagaaa
aacaacaagaagacaagcaaaaacaagagcagtcttagtagagggagtaagaagaagcct
ggaatgccaaatgtgtccaatgacctatcccagaagctctatgctacaatggaaaagcat
aaagaggtattttttgtcatccgccttagtgctggacccgcagcaaattctcttccccca
attgtagagccagaccccctaattccttgtgatttaatggacggacgggatgccttcctc
acgcttgctagagataaacacttggagttttcatctctgcgcagagctaagtggtctaca
atgtgcatgctggtggaactccatacacagagccaggaccgctttgtctacacctgcaat
gagtgcaagcaccatgttgaaacgcgctggcactgtactgtttgtgaggattatgatttg
tgcatcacctgctacaacacaaagacgcatgagcacaaaatggagaaacttgggcttggc
ttggatgatgagagcaataaccaacaagcagcagcaacccaaagccctggagattctcgc
cggctgagcattcagcgctgcatccagtcccttgtacatgcttgccagtgtcgcaatgca
aactgctctctgccctcatgtcaaaagatgaagagagttgtacaacacaccaaaggctgc
aagagaaaaaccaatggagggtgtcctatctgcaagcagcttattgccttgtgctgctac
catgctaaacactgccaagaaaacaagtgcccagtgcccttctgcctcaatattaagcaa
aagctccgtcaacagcaactgcagcataggttgcaacaggctcagatgctgcgacggcgt
atggccagcatgcagagagcaggaggggtgggccctcagcagggtctgccttctccaaat
tctgctggccctgccacaccaacaggccaacagccccccacgccacagactcctcaacca
ccaccccaacctccaactcagcagcagcctccaccacctaacatgcctccctacagcatg
gcacgtgctgagcccgccaggggtatatcacagggcaaggcagctgggcaaatgactcct
ccaacacctccccaggctggggcaatgcagcagcaggttcagggtccaccaccagctgct
gtagagatggcaatgcagatccagcgggctgcagaaacacagaggcaaatggcaaaagct
caaatttttcctcggcccatgatgaacccacatcagatgcaacctatgaacccaatgcag
cccatgggaatgaatcctcagcaaggccctcggggtcaagttcatatggagtctggtata
gggcctggaatgcagcaacctcagcagcagcagcagccacctccaactcaaccacaacct
ccatgggtacaaagtggtctgccccagtcacaatcaatgcaacctggcatgcaaagatca
cctattatgtcagtaccacaacagggacagcctatgaatatgaatccccagtctggcatt
ggacaggtgcctggagcaagccaaacaaaacaaggctcactgccacaagctgctctgcag
aaccttcttcgcactttgcgttctcccagctcaccaatgcaacagcagcaggttctgaat
attttgcactcaaacccacagcttctggctgcctttatcaagcaaagagcagctaagtat
gctagtagccagaatgcacaggcagctggcaatgttccagggatgcctgcccaggctggc
cttcagcaggtagtgcattctaatcctggcatgcaaggcatgaaccctatgcaggcaatt
ggtccacgccctggcatgcctcagcaaccccaggcaccccagcagcagcccccacagcag
tcccctcttccccaacaggcaatggcaggtataaatccacagggtcagccattaaacatc
aatcctggtgggatttcccctcagttccgtgagattatcctgcgaaggcagcaaataatg
cagcaacagcagcaacagcagcagcagcagcagcaacaacagcaacaacagcagcagcag
cagcagcaaggagctggacccggaatggttaatcataaccagttccagcagcaccaagtt
atgtctggctacacacaacagcagcagcagcaacagcgattccagcaccacatccagatg
cagcaaggaagtatgggacaaatgagccagatgccacagggaatgccaggtgatacatcg
agtggcttgcagacctttccacagcgcctcttacaccagcagatgggatctccagcgcaa
caaaacccaatgagcccgcagcagcacatgttgccaggccctgcccagtcccctcattta
cagggacagcagctccctccatcacttagcaaccaagttcgctctccacaacctgtgccc
tccccacgcccccagtcacaacccccacactccagcccatctccccgtatgcagccccag
ccatcccctcaccacgtttctcctcagaccagctctcctcacccagggttggtggggcct
gggcaagggaaccctatggatcaaggacactacggaagcccggatcctactgctatgctt
tcgcagatggcaggtcttcatggagggggggtgcaagaccttggcctgggtgcggacaac
tcggaccttaatcccaacctctcacagagtacactagatatccattag

DBGET integrated database retrieval system