KEGG   Xenopus tropicalis (western clawed frog): 779515Help
Entry
779515            CDS       T01011                                 

Gene name
mapk10, jnk3, jnk3a, p493f12, p54bsapk, prkm10
Definition
mitogen-activated protein kinase 10 (EC:2.7.11.24)
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Adipocytokine signaling pathway
Salmonella infection
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    779515 (mapk10)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    779515 (mapk10)
   04012 ErbB signaling pathway
    779515 (mapk10)
   04310 Wnt signaling pathway
    779515 (mapk10)
   04068 FoxO signaling pathway
    779515 (mapk10)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    779515 (mapk10)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    779515 (mapk10)
   04621 NOD-like receptor signaling pathway
    779515 (mapk10)
   04622 RIG-I-like receptor signaling pathway
    779515 (mapk10)
  Endocrine system
   04910 Insulin signaling pathway
    779515 (mapk10)
   04920 Adipocytokine signaling pathway
    779515 (mapk10)
   04912 GnRH signaling pathway
    779515 (mapk10)
   04914 Progesterone-mediated oocyte maturation
    779515 (mapk10)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    779515 (mapk10)
   05168 Herpes simplex infection
    779515 (mapk10)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     779515 (mapk10)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   779515 (mapk10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 441 aa AA seqDB search
MSRHFLYNCSEPTLDVKIAFCQGFGNQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDEALQHPYIN
VWYDPSEVEAGPLRDIWNEQPVKTKNNEKPPPQIYDKQLDEREHTIEEWKELIYKEVMNF
EEKTKNGVVKGQPSPSAQVQQ
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtcatttcttgtataactgcagtgaacctactctggatgtgaagattgccttt
tgtcagggattcggtaatcaagtggatgtgtcgtatattgctaaacattacaacatgagc
aaaagcaaagttgacaaccagttctacagtgtggaagtaggagactcgacattcactgtt
cttaaacgctaccagaatctaaaacctataggctctggagctcagggaatagtttgtgct
gcctatgatgctgtccttgatagaaatgtggcaattaagaaactaagtagaccatttcag
aatcaaacacatgccaaacgggcatatagagagttggtccttatgaagtgtgtaaatcat
aaaaatattatcagtttattaaatgtcttcacaccccagaaatctcttgaggagttccag
gatgtatacctagttatggaactgatggatgctaacttgtgccaagtgattcagatggaa
ctagatcatgaacgaatgtcttatttgctctaccaaatgctatgtggaataaagcacctt
cattcagctggaattatacatagggatctaaagccaagtaatattgttgtgaagtcggat
tgcacattgaagatccttgactttggattggcaaggacagctggtactagtttcatgatg
actccttatgtagttacccgttactacagagctccagaagttatacttgggatgggatac
aaagagaatgtggatatttggtctgtgggatgcattatgggagaaatggtccgccacaag
atcctctttccaggaagggactatattgaccagtggaacaaagtaatagaacagctggga
actccgtgcccagagtttatgaaaaagctacaaccaacagtacgaaactatgtggaaaat
cgacctaaatatgctggtctcacttttccgaagctatttcccgattccctctttccagca
gattcagagcataataaactcaaagccagtcaagcaagagatcttttatcaaagatgctt
gtcattgatccagccaagagaatatcagttgatgaagcgctacagcatccgtatatcaat
gtctggtatgacccttcagaagttgaggcgggccctctgagggatatatggaatgaacag
ccagtcaaaacaaagaataatgaaaagcctccccctcaaatctatgacaaacaactggat
gaaagagaacataccattgaagaatggaaagaactaatctataaggaagtgatgaacttt
gaagaaaaaactaaaaatggtgttgtaaaaggacagccctctccttcagcacaggtgcag
cagtga

DBGET integrated database retrieval system