KEGG   Xenopus tropicalis (western clawed frog): 779516Help
Entry
779516            CDS       T01011                                 

Gene name
pex1
Definition
peroxisomal biogenesis factor 1
Orthology
K13338  
peroxin-1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Peroxisome
Class
Cellular Processes; Transport and catabolism; Peroxisome [PATH:xtr04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 1205 aa AA seqDB search
MLGPGPPGAAVSLKLTSAKDTFLRVTPEVLAQLRLEQKHAVEVSWSDQEPVYLCWMERRS
GTCSRTNVAELNRQFGEILGFSDGQQVFLKQCTNVISCKEVTVEPLTADDWDILELHSSA
LESRLLDQIRIVYPKAIFPVWVDPHTCIYLQIGALTPQSSYGRLEPLTELIVAPKQRNLE
TISPAFIPPGPEDLDVNFSHEKSDHKQSRTADSQRQSTEGESGPTESDHSDSLSSSKSIW
DTVGDFLLRSLGRKPALSLGSSETELIKKSLVKKVELEAVFRVSSRIPHIVKSSQEYNDY
ANDNCVHVFLWYPEPPGLVPDIVVTFGTIQELLSPKRRKESTRKNTEPSEKKPDGIAPGS
PKQRNSDTKGHSATVKIVWHGFDDLKDVIEYDTRNGNTHVGKVWVPSQLRKKLNINISSA
VRIHSHDSVLRLPTSLTLQPAQTLDRNIHEDEIKAAFSTWLQSNSTLKMPWIAGNTGYIQ
IILKDEVSDFFIILDKLDLQSSQDDFYMLCPSIMEKTKIHVNFEPAPSEESHRHLHADQN
LLYLKLQNLGGVSKLGKSCYDHVVHCLLGRPLSRQLVASASGLRSGGVLLCGPKGSGKST
LAKALCKEASEQLEAHVEEIDCKLLKGKNVENIIQTLEEAFEEAAWRQPSVILLDDLDQI
AGVASSPELEQSPEATQSKQLAYVLKDLMKNIISMDTLVSLIATCQSEHSLNPVLISEQG
THLFQCVKPIPPPTQENRSEMLRCVIENRLSGDTAFYRDLDFQYLARETEGFVARDFTML
VERAIESSVSKRQICRIEDLVLSTTDFQRALKGFTPLSLRNAQLHKPKKQDWNMVGGLHD
IRQVLKDTIELPAKYPELFANLPIRHRSGVLLYGAPGTGKTLLAGVIAHESRMNFISIKG
PELLSKYIGASEQAVRDVFTRAQAAKPCILFFDEFDSIAPRRGHDNTGVTDRVVNQMLTQ
LDGVEGLQGVYVLAATSRPDLIDPALLRPGRLDECLYCPPPDQDSRFEILKGLSHSMLLD
ENVDLKHIASLTDYFTGADLKALLYNAQLEAIHTNLSVTVPQDNNSGSDSDMSLSSIIFL
NHSSASDDSGGDQDSVLDHSLPSLDMIKLPIEDIHSSMWRLYFGNSYDSDLGNGSSEQVY
DSHSQMESKKSLLIKQHHLLNALASTRPSISQEDWKFFNHLYENFKNPKQSSRETWRSGQ
KVTLA
NT seq 3618 nt NT seq  +upstreamnt  +downstreamnt
atgctaggtccgggaccgcccggggctgctgtgtccctgaaactcacaagtgctaaggac
acatttttgcgtgtgacacctgaggtgctcgcacaattacgcctggagcagaaacatgca
gtggaggtgtcatggagcgatcaggagccagtgtatctatgctggatggagagaaggagt
ggcacttgctcacgtacaaatgtggctgaactgaacagacagtttggtgagatccttgga
ttttcagatgggcagcaggtctttctcaagcagtgcactaatgtcatttcttgtaaggag
gtcactgtcgagcccctgactgctgatgactgggacatactggaacttcattcttcagcc
cttgaatcccgtcttttggatcaaattcgaatagtttatcctaaggctatatttccagta
tgggttgacccacatacttgcatttaccttcagattggtgcactgacgccacagtctagt
tatggcagactggaaccacttacggagttaattgttgctccaaaacagcgaaacttagaa
accatttccccagcatttatacctccaggacctgaggatttggatgttaatttcagccat
gaaaaaagtgatcacaaacaaagcagaactgcagacagtcaaaggcaatcaactgaagga
gaaagtggacctacagagtcagaccattctgatagtttatccagtagcaaaagtatttgg
gacacagtaggagattttcttttacggtctctggggaggaaaccagccctctctttaggt
agcagtgaaacagaactaattaagaagtctttggttaaaaaagttgagttagaagctgtt
tttagggtatccagtcgcatccctcacattgttaaaagcagccaggaatataatgactat
gccaacgataactgtgttcatgttttcttatggtaccctgagcctcctggtttagtacct
gatattgttgtaacatttggaacaattcaggaacttttatcaccaaaaagaagaaaagaa
agtacaagaaaaaacactgagccatcagaaaaaaaaccagatggtattgctccgggaagc
ccaaaacagaggaattctgacaccaaaggacacagtgcaacagtgaagatagtatggcat
ggctttgatgatctcaaagatgtaatcgagtatgatactaggaatggaaacacacacgtt
ggaaaagtctgggtcccatctcagttgagaaagaaactcaatatcaatatttcctcagct
gtaagaatacactcacatgattcagttctcaggctcccaacttcactcacactacagcca
gcgcagactttggatagaaacatacatgaagatgaaatcaaagctgcattcagtacttgg
ctgcagtctaatagtaccttaaagatgccttggattgcagggaacactggttatatacag
attattttaaaggatgaagtatcggatttcttcattattttggataaattagaccttcaa
tcaagccaagatgatttttatatgttatgcccaagcattatggagaaaactaaaattcat
gtgaattttgagccggccccctctgaagagtctcatagacacctacatgcagatcaaaat
cttctttacttgaaactgcaaaatttaggaggggtgagtaaactggggaaatcatgctat
gatcatgttgttcattgtctcctgggccggccactctccagacagctggttgcatctgct
tctggtcttcgtagcggaggagttcttctttgtggacctaagggaagcggaaaatcaact
ttagcaaaagccttatgtaaagaagcatctgagcaactggaagcacatgtagaagaaatt
gattgtaaactattaaaagggaaaaacgttgaaaatattattcagacactagaagaagct
tttgaagaagccgcctggagacagccttcagttatacttttagatgatctggatcaaatt
gctggtgttgcttcttcccctgaactggagcagagtcctgaagcaactcaaagcaaacaa
cttgcatatgttttgaaagatttaatgaagaatataatttccatggacactctggtgtct
ctaatagctacatgtcaatctgaacattctctgaatcctgtgctaatttctgagcaaggg
acacatcttttccagtgtgtgaaacccatcccaccaccaacacaggaaaacagatctgag
atgctacgctgtgtgatagagaaccggctaagtggtgatactgctttctatagagacctt
gacttccagtatcttgcaagagaaacagaaggctttgtggcaagagactttaccatgctt
gttgaacgagccatagagtctagtgtgtcaaagcgacagatatgcaggatagaagatttg
gttttgtcaacgactgacttccaaagagctctaaaaggctttactccattgtccttaaga
aatgctcagctgcataagccaaagaaacaggactggaacatggtgggaggtttacatgat
attcgccaggttcttaaagacaccattgagttaccagccaagtatcctgagctatttgca
aaccttcccatacgccacagatctggagtgttgctgtacggtgcacccggaacagggaag
acgctgctggctggtgttattgctcatgaaagtagaatgaatttcatcagcattaagggc
ccagagcttctcagtaaatacatcggggcaagtgaacaagcggtgcgggatgtctttacc
agagcccaggctgctaagccttgtattctattctttgatgagtttgattccattgctcct
cggagaggccatgataacactggtgtaactgacagagtggtcaaccagatgctgacacag
cttgatggtgtggaaggattacaaggagtgtatgttttggcagccactagtcgccctgac
ttgattgatcctgcgctactcagacctggacgtttggatgaatgcctatattgcccccca
ccagaccaggactcacgatttgaaatcttaaaaggcctcagccattccatgcttttagat
gaaaatgtggacttgaagcatattgcctctctgacggattacttcacaggagcggatctt
aaagccttgctgtataacgctcagctggaggcaattcatactaacctgtcggtaaccgtt
cctcaggacaacaattctggatctgacagtgatatgagcttgtcttccataatattcctg
aaccacagcagtgcttctgatgactcgggaggagaccaagatagtgttctagatcactct
ttaccctccttggatatgataaagcttcccatcgaagacattcattccagcatgtggcgt
ctttactttggaaattcatatgattcagaccttggaaacggcagttcagaacaggtctat
gactcccacagccaaatggagtccaagaagagccttctgattaagcagcatcaccttctc
aatgcgcttgccagcacaaggccatccattagccaagaggactggaagttttttaaccac
ctttacgaaaactttaaaaacccaaagcagtcgagcagagaaacttggagaagtggacaa
aaagtgacccttgcctaa

DBGET integrated database retrieval system