KEGG   Xenopus tropicalis (western clawed frog): 779516Help
Entry
779516            CDS       T01011                                 

Gene name
pex1
Definition
(RefSeq) peroxisomal biogenesis factor 1
  KO
K13338  peroxin-1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    779516 (pex1)
Membrane trafficking [BR:xtr04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    779516 (pex1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA PEX-2N PEX-1N AAA_16 AAA_2 RNA_helicase AAA_22 AAA_5 RuvB_N AAA_14 AAA_18 AAA_33 ABC_tran IstB_IS21 Sigma54_activ_2 DUF815 TIP49 Sigma54_activat AAA_24 Mg_chelatase AAA_28 AAA_19 RsgA_GTPase AAA_29 T2SSE NB-ARC Parvo_NS1 ATPase Roc Rad17 FtsK_SpoIIIE AAA_23 ARL17 APS_kinase Ribosomal_60s MMR_HSR1 CLP1_P
Motif
Other DBs
NCBI-GeneID: 779516
NCBI-ProteinID: XP_002934633
Xenbase: XB-GENE-985415
Position
6
AA seq 1205 aa AA seqDB search
MLGPGPPGAAVSLKLTSAKDTFLRVTPEVLAQLRLEQKHAVEVSWSDQEPVYLCWMERRS
GTCSRTNVAELNRQFGEILGFSDGQQVFLKQCTNVISCKEVTVEPLTADDWDILELHSSA
LESRLLDQIRIVYPKAIFPVWVDPHTCIYLQIGALTPQSSYGRLEPLTELIVAPKQRNLE
TISPAFIPPGPEDLDVNFSHEKSDHKQSRTADSQRQSTEGESGPTESDHSDSLSSSKSIW
DTVGDFLLRSLGRKPALSLGSSETELIKKSLVKKVELEAVFRVSSRIPHIVKSSQEYNDY
ANDNCVHVFLWYPEPPGLVPDIVVTFGTIQELLSPKRRKESTRKNTEPSEKKPDGIAPGS
PKQRNSDTKGHSATVKIVWHGFDDLKDVIEYDTRNGNTHVGKVWVPSQLRKKLNINISSA
VRIHSHDSVLRLPTSLTLQPAQTLDRNIHEDEIKAAFSTWLQSNSTLKMPWIAGNTGYIQ
IILKDEVSDFFIILDKLDLQSSQDDFYMLCPSIMEKTKIHVNFEPAPSEESHRHLHADQN
LLYLKLQNLGGVSKLGKSCYDHVVHCLLGRPLSRQLVASASGLRSGGVLLCGPKGSGKST
LAKALCKEASEQLEAHVEEIDCKLLKGKNVENIIQTLEEAFEEAAWRQPSVILLDDLDQI
AGVASSPELEQSPEATQSKQLAYVLKDLMKNIISMDTLVSLIATCQSEHSLNPVLISEQG
THLFQCVKPIPPPTQENRSEMLRCVIENRLSGDTAFYRDLDFQYLARETEGFVARDFTML
VERAIESSVSKRQICRIEDLVLSTTDFQRALKGFTPLSLRNAQLHKPKKQDWNMVGGLHD
IRQVLKDTIELPAKYPELFANLPIRHRSGVLLYGAPGTGKTLLAGVIAHESRMNFISIKG
PELLSKYIGASEQAVRDVFTRAQAAKPCILFFDEFDSIAPRRGHDNTGVTDRVVNQMLTQ
LDGVEGLQGVYVLAATSRPDLIDPALLRPGRLDECLYCPPPDQDSRFEILKGLSHSMLLD
ENVDLKHIASLTDYFTGADLKALLYNAQLEAIHTNLSVTVPQDNNSGSDSDMSLSSIIFL
NHSSASDDSGGDQDSVLDHSLPSLDMIKLPIEDIHSSMWRLYFGNSYDSDLGNGSSEQVY
DSHSQMESKKSLLIKQHHLLNALASTRPSISQEDWKFFNHLYENFKNPKQSSRETWRSGQ
KVTLA
NT seq 3618 nt NT seq  +upstreamnt  +downstreamnt
atgctaggtccgggaccgcccggggctgctgtgtccctgaaactcacaagtgctaaggac
acatttttgcgtgtgacacctgaggtgctcgcacaattacgcctggagcagaaacatgca
gtggaggtgtcatggagcgatcaggagccagtgtatctatgctggatggagagaaggagt
ggcacttgctcacgtacaaatgtggctgaactgaacagacagtttggtgagatccttgga
ttttcagatgggcagcaggtctttctcaagcagtgcactaatgtcatttcttgtaaggag
gtcactgtcgagcccctgactgctgatgactgggacatactggaacttcattcttcagcc
cttgaatcccgtcttttggatcaaattcgaatagtttatcctaaggctatatttccagta
tgggttgacccacatacttgcatttaccttcagattggtgcactgacgccacagtctagt
tatggcagactggaaccacttacggagttaattgttgctccaaaacagcgaaacttagaa
accatttccccagcatttatacctccaggacctgaggatttggatgttaatttcagccat
gaaaaaagtgatcacaaacaaagcagaactgcagacagtcaaaggcaatcaactgaagga
gaaagtggacctacagagtcagaccattctgatagtttatccagtagcaaaagtatttgg
gacacagtaggagattttcttttacggtctctggggaggaaaccagccctctctttaggt
agcagtgaaacagaactaattaagaagtctttggttaaaaaagttgagttagaagctgtt
tttagggtatccagtcgcatccctcacattgttaaaagcagccaggaatataatgactat
gccaacgataactgtgttcatgttttcttatggtaccctgagcctcctggtttagtacct
gatattgttgtaacatttggaacaattcaggaacttttatcaccaaaaagaagaaaagaa
agtacaagaaaaaacactgagccatcagaaaaaaaaccagatggtattgctccgggaagc
ccaaaacagaggaattctgacaccaaaggacacagtgcaacagtgaagatagtatggcat
ggctttgatgatctcaaagatgtaatcgagtatgatactaggaatggaaacacacacgtt
ggaaaagtctgggtcccatctcagttgagaaagaaactcaatatcaatatttcctcagct
gtaagaatacactcacatgattcagttctcaggctcccaacttcactcacactacagcca
gcgcagactttggatagaaacatacatgaagatgaaatcaaagctgcattcagtacttgg
ctgcagtctaatagtaccttaaagatgccttggattgcagggaacactggttatatacag
attattttaaaggatgaagtatcggatttcttcattattttggataaattagaccttcaa
tcaagccaagatgatttttatatgttatgcccaagcattatggagaaaactaaaattcat
gtgaattttgagccggccccctctgaagagtctcatagacacctacatgcagatcaaaat
cttctttacttgaaactgcaaaatttaggaggggtgagtaaactggggaaatcatgctat
gatcatgttgttcattgtctcctgggccggccactctccagacagctggttgcatctgct
tctggtcttcgtagcggaggagttcttctttgtggacctaagggaagcggaaaatcaact
ttagcaaaagccttatgtaaagaagcatctgagcaactggaagcacatgtagaagaaatt
gattgtaaactattaaaagggaaaaacgttgaaaatattattcagacactagaagaagct
tttgaagaagccgcctggagacagccttcagttatacttttagatgatctggatcaaatt
gctggtgttgcttcttcccctgaactggagcagagtcctgaagcaactcaaagcaaacaa
cttgcatatgttttgaaagatttaatgaagaatataatttccatggacactctggtgtct
ctaatagctacatgtcaatctgaacattctctgaatcctgtgctaatttctgagcaaggg
acacatcttttccagtgtgtgaaacccatcccaccaccaacacaggaaaacagatctgag
atgctacgctgtgtgatagagaaccggctaagtggtgatactgctttctatagagacctt
gacttccagtatcttgcaagagaaacagaaggctttgtggcaagagactttaccatgctt
gttgaacgagccatagagtctagtgtgtcaaagcgacagatatgcaggatagaagatttg
gttttgtcaacgactgacttccaaagagctctaaaaggctttactccattgtccttaaga
aatgctcagctgcataagccaaagaaacaggactggaacatggtgggaggtttacatgat
attcgccaggttcttaaagacaccattgagttaccagccaagtatcctgagctatttgca
aaccttcccatacgccacagatctggagtgttgctgtacggtgcacccggaacagggaag
acgctgctggctggtgttattgctcatgaaagtagaatgaatttcatcagcattaagggc
ccagagcttctcagtaaatacatcggggcaagtgaacaagcggtgcgggatgtctttacc
agagcccaggctgctaagccttgtattctattctttgatgagtttgattccattgctcct
cggagaggccatgataacactggtgtaactgacagagtggtcaaccagatgctgacacag
cttgatggtgtggaaggattacaaggagtgtatgttttggcagccactagtcgccctgac
ttgattgatcctgcgctactcagacctggacgtttggatgaatgcctatattgcccccca
ccagaccaggactcacgatttgaaatcttaaaaggcctcagccattccatgcttttagat
gaaaatgtggacttgaagcatattgcctctctgacggattacttcacaggagcggatctt
aaagccttgctgtataacgctcagctggaggcaattcatactaacctgtcggtaaccgtt
cctcaggacaacaattctggatctgacagtgatatgagcttgtcttccataatattcctg
aaccacagcagtgcttctgatgactcgggaggagaccaagatagtgttctagatcactct
ttaccctccttggatatgataaagcttcccatcgaagacattcattccagcatgtggcgt
ctttactttggaaattcatatgattcagaccttggaaacggcagttcagaacaggtctat
gactcccacagccaaatggagtccaagaagagccttctgattaagcagcatcaccttctc
aatgcgcttgccagcacaaggccatccattagccaagaggactggaagttttttaaccac
ctttacgaaaactttaaaaacccaaagcagtcgagcagagaaacttggagaagtggacaa
aaagtgacccttgcctaa

DBGET integrated database retrieval system