KEGG   Xenopus tropicalis (western clawed frog): 779539Help
Entry
779539            CDS       T01011                                 

Gene name
kmt2e, mll5
Definition
lysine (K)-specific methyltransferase 2E
Orthology
K09189  
histone-lysine N-methyltransferase MLL5 [EC:2.1.1.43]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    779539 (kmt2e)
Enzymes [BR:xtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     779539 (kmt2e)
Transcription factors [BR:xtr03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    779539 (kmt2e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 1782 aa AA seqDB search
MSIAIPLRVDTAEAPYLEMAAGSEPESVEASPVVIDKSNSYPHQLYTSSSHHSHSYIGLP
YADHNYGARPPPTPPASPPPVLSKNEVSIFTAPNFDETSSATTISTSEDGSYGTDVTRCI
CGFTHDDGYMICCDKCSVWQHIDCMGIDRQNIPDIYLCERCQPRALDKERAVLLQQKKRE
HLSDGDTSATESCDEVPMELYTAFQHTPTTLTLTATRVNKVNDKKRKKSGEKEQNNSKVK
KAFREGSRKSSRVKGSAPEIDPLDNYAFGWENKIKTWMDHYEEASNNQYSEGVQKEAQRI
ALRFSNENDNKEQIKTNFNTSNLIFKPPVESYLQKNKKILKAAKDLLPETLIIEYRGKFM
LREQFEANGYFFKRPYPFILFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHVIEE
GTIHLYIYSISSIPKGAEITIAFDFDYANCKYKVDCACFKDNPDCPVLRCSTEPTENNSG
YETRRKKGKKEKELLKERESQNQNIVIDSDGAINKFKTSDNKQRKLSPLRLSISNNQEPD
INDDIEENTPLSNDVEMETEEQIAERKRKMTREERKMEAILQAFARLEKREKRREQALER
IGTSKPDVKTESKDLQIISELELPPEPVKEEPASKPTPAKINRTKQRKSFTRSRTHIGQQ
RRRHRTISTCSDIQPSSPDVEVVPQQIETENNAVPEEPPNESSPHNTEEVPETESCVQSK
CSIKYPKTKKHLVNEWLNEKHEKAGKPGEPILERPLRITTDPEVLATQLNSLPGLMYSPH
VYTTPKHYIRFTSPFLSEKKKKKNEENVSSCCKKRWLKKALEEENSSGVNPFGSPAQDRS
QSPVSLHENKCHLIMNGSSPLADFTTPLKKRRLFNFLDCNFSESSTPVASPYATPTHTDI
TSMDTSLFTTPPRVKVEEEICRNGCKQTYSPVTPVTPCLRGNNMHFESISSPDSSPEVNR
RSFCQEGNDRASTALNSFRNTSLSDMGLQEIKTFGYCSPRNRTDVSGQCPGENDAASEVH
FGADINEHSSLQKVMEPPQDRTDLNSLQETALSGQGTMYSTWIKSPNRTGVNFLSMNSNL
RDLTPSHQLEVGGGFRMNESKCLIPEDSRGVFIDGPIFCSAEEGTVSGFGRSLGGDGILD
GNGTPLNPPQKKKVSLLEYRKRQKEARKSGSKQENLSLVTLSPHPDGIVNCTPSESCSAV
AECIDQNDASTCLTQPSEVQSVPSEETEQTSSVTDTSSTEKNDPEVQWTASTCVEQVRER
SYQRALLLSDHRKDKDDADIEGGDPANAKECQSPDISSKNCRSPKQSKPCSLVPNLSHGK
TPSKLDPAQETMVNPSTTADVNFCNTDSQQKQLLSKSLIPHAQKLPSTPLKLHCPSSPLL
EHPPKSSTPVQHGYLSPKPHSQKLGSPYRPHHPQQHQVGTPQRESLPNFYPVVQSLQPAN
PQPSSGQLFSQTQPGQCSNVYTPFNQQTASSPAPPPPPPPPTATYYQNQQPSINFQNFSQ
IKGAVSQQTVFTPGPNQGHPTAAGQPAIQGHHVNSGHYLPSQSPNVHLQATGVPPPPPPP
LPSCHQQHSVQHVTSPGHTVPVASSSHIHSQTPGHHLPPPPPPPPGPSPHHSHLQHVSAG
HQGLQVQHQHVLNTVPPPPPPPPPPPPQAANVLGGAGNHTASAQVIHMQTHQGPVFSSGA
HPSVAPYSTQASHHNQVGPVPQHQSSATGPHLPLPGQNSHIQTQGPNSIATPAGFCPHPG
SVSLAHGVQGPQQASTVPGQVPIHRPQVPPTFQNNYHGSGWH
NT seq 5349 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagcgatccctttgcgggttgacacagcagaggctccttatctagaaatggct
gcaggctcagaaccagaatctgtagaagctagccctgtcgtcattgataagtcaaatagt
tatccacatcagttatataccagcagttctcatcattcgcacagttatattggattgcct
tatgcggatcacaactatggtgctcgccctccaccaacacctccagcatctcctcctcct
gtccttagtaagaatgaagtaagcatatttactgctcctaactttgatgagacttccagt
gctacaacaataagtacttcagaagatgggagctatggaactgatgtcactagatgtatc
tgcggttttactcatgatgatggatatatgatttgttgtgacaaatgcagtgtctggcaa
catattgattgtatgggtattgacaggcaaaatattccagacatctacttatgtgagcgt
tgtcagcctcgggctttggataaagagagagcagttttacttcagcagaaaaagcgagaa
catttgtcagatggtgacaccagtgcaacagaaagttgtgatgaagttcccatggaactg
tacactgctttccagcacaccccaacaactcttactctcactgccactagagtaaataag
gttaatgacaaaaagaggaagaaaagtggtgagaaggagcagaataattctaaagttaag
aaggcttttcgtgaaggatcaagaaaatcatcacgtgttaagggctctgctccagaaatt
gatcccttagacaattatgcttttggatgggagaataaaatcaagacttggatggaccac
tatgaagaagcaagcaacaaccaatacagtgaaggggttcaaaaagaggcacaaaggatt
gctttgagattcagtaacgaaaatgataataaagaacaaataaagaccaactttaacacc
agcaatctaattttcaagccaccggtagagagctatctacaaaagaacaaaaaaatctta
aaggctgccaaagacttgcttcctgaaacactaattatagaatacaggggaaaatttatg
ctccgggagcagtttgaagcaaatgggtatttctttaaaaggccatacccttttattttg
ttttattctaaatttcatggattagaaatgtgtgttgatgcaaggacatttggaaatgag
gctcgatttatacgacgttcctgcacacctaatgctgaggtgcgacatgttattgaagaa
ggaactattcacctatatatatactccatttcaagcattccaaaaggggcagaaatcact
attgcttttgattttgattatgcaaattgtaaatataaggtggattgtgcatgcttcaaa
gacaatccagactgcccagttctccgatgcagtacagagcctacagaaaataacagtggc
tatgaaactagaagaaaaaaggggaaaaaggaaaaagaacttttaaaagaaagagaatct
caaaaccagaacattgtaatagattcagatggagcaattaacaaatttaaaacatcagat
aacaagcaaagaaagctctcccctcttagattgtcaatatcaaacaaccaggagccagat
attaatgatgatatagaagaaaatactcctcttagcaatgacgtagaaatggaaacagag
gagcagattgcagaaagaaaaaggaagatgactagagaagaaagaaaaatggaagctatt
ctgcaagcttttgcaagactggaaaaaagagaaaaaagaagagaacaagctttagaaaga
attggcacttccaaaccagacgtgaaaacagagagcaaggacttacagattatcagtgaa
ttggagctccctccggaaccagttaaggaagaacctgccagcaaacctactcctgccaaa
ataaatcgcacaaagcagcgaaagagttttacaagaagtaggactcatattggacaacag
cgtcgtcggcaccggactataagtacctgctcagatatccagccatcttccccagatgtt
gaggttgtaccacagcagattgaaacagaaaataatgctgtacctgaagaacctccaaat
gaaagcagtccccataatacagaagaagttccagagacagaatcttgtgttcaaagcaaa
tgttctataaagtacccaaaaacaaaaaagcacttggtaaatgaatggttaaatgaaaag
cacgagaaagctggcaaacctggagagcccatattggaaagacctttaagaataaccaca
gatcctgaagtccttgctactcagctgaattccttaccaggtttaatgtatagtcctcat
gtgtacaccactcctaagcattatattaggtttacatcaccattcctttctgagaaaaag
aagaagaaaaatgaagagaatgtttccagttgttgcaaaaagcgttggttgaagaaagct
ctggaagaagaaaattcttcgggggttaatccatttggttctcctgctcaggaccgatct
caaagtccggtttcattacatgaaaataaatgccatctaataatgaatggcagctctccc
ctggcagattttacaactccactgaagaaacgaaggttgtttaattttttggattgcaat
ttttccgaaagttcaacaccagttgcatctccttatgctacccctacacatactgatatt
acttccatggatacatccttatttactactccacccagggtaaaagtagaagaggaaatc
tgtcgcaacggttgcaagcaaacctactcaccagttactccagtaacaccctgtctgcgt
ggaaacaacatgcattttgagagtatttcttcacctgatagttcaccagaagtgaaccga
agatctttttgtcaggaaggaaatgaccgggcatctacagcattgaattctttcagaaat
accagtttgtctgacatggggcttcaagaaataaagacttttggctactgcagccctagg
aataggactgatgtttctggtcagtgtcctggtgaaaatgatgctgcatcagaggtccat
tttggagcagacataaatgaacatagctctctgcaaaaggtcatggagcctccacaggat
aggactgatttaaatagcctacaggaaactgctcttagtggacaaggcaccatgtattca
acttggattaaaagtccaaatagaacaggggtgaacttcttgtccatgaattctaattta
agagatttaaccccttctcaccagcttgaagttggtggtggattcagaatgaatgaatcc
aaatgcttgatcccagaagactcacggggcgttttcatagatgggcctatcttctgctct
gcagaggagggaactgtttctggatttggaagatctcttggtggtgatgggatattagac
ggaaatggtacaccacttaatcctccgcaaaagaaaaaggtgtcattgctggaatataga
aaaagacagaaagaagcaagaaaaagtggctctaaacaggaaaatttatctctggtcact
ttatctcctcatccggatggtattgtcaactgcaccccttctgaaagttgtagtgctgtt
gcagagtgtattgatcaaaatgacgctagcacttgtttaactcagccatctgaagtccag
tctgtcccttctgaagaaaccgaacaaacttcttcagtaactgacacctcatccactgaa
aaaaatgatcctgaagtgcagtggactgcatcaacatgtgttgagcaagtcagagagaga
agctatcaaagagctttgttactgagtgaccacagaaaggacaaagatgatgctgacata
gaaggtggggaccctgctaatgccaaggaatgccagtcaccagacatatccagtaagaat
tgtagaagtcctaaacagagtaagccctgttctctggtgcctaatttatctcatggaaag
acgccctcaaagctagatcctgcccaagaaaccatggtgaatccatcaacaactgctgat
gttaatttttgtaacaccgattctcagcagaaacagctcctttctaagtctctcattccc
catgctcagaagctaccttctacacctttaaagttgcattgtccgtcatctcctcttctt
gaacaccctccaaaatcttcaacaccagtacaacatggttatctttcaccaaagcctcat
tcacaaaaattaggttctccatataggccacatcatccccagcagcatcaggtgggaaca
ccacaaagagagtctcttccaaacttttaccccgtagtgcaaagccttcagcctgctaat
ccacagccctctagtggccagttgttttcccagacccagccaggacagtgctccaatgtt
tatactccctttaatcaacagaccgccagcagtcctgctccacctcccccacccccacct
ccaacagcaacttactatcaaaaccagcagccctctataaacttccagaactttagtcag
ataaagggagctgtgtcccaacaaactgtgtttacacctggtccaaatcaaggtcatcca
actgcagcaggacaaccagcaattcaaggacaccatgtaaactctggacattatttgcct
tctcaaagccctaatgtacatctccaagctacaggggttccaccacccccaccgccacct
cttccaagctgccatcagcagcactctgttcagcatgttacaagcccaggtcatacggtt
ccagtagccagtagctcacatattcattctcagacaccagggcatcatttacctccacca
ccccctccaccacctggcccaagtcctcatcattcgcatcttcagcatgtatcagcagga
caccaaggcctgcaagtgcagcaccagcatgttttaaatacagttcctccacctccccca
ccaccacctccaccccctccacaagcagcaaatgttttaggtggtgctggaaatcacacg
gcatcagcacaagttattcatatgcaaactcatcaaggacctgttttctcttcaggagct
catcctagtgtagcaccatattcaacacaagcttcccatcataaccaagttggacctgta
ccacagcaccagtcttctgccacaggaccgcatctcccacttcctggccagaactctcat
attcagacacaaggaccaaacagtattgcaacacctgcaggtttttgtccgcatcctggc
tctgtaagccttgctcatggagttcaaggacctcagcaggcatcaacagtgcctggccag
gttcctattcataggccacaggtacctccgaccttccagaataattaccatggctcagga
tggcattag

DBGET integrated database retrieval system