KEGG   Xenopus tropicalis (western clawed frog): 779632Help
Entry
779632            CDS       T01011                                 

Gene name
alad
Definition
aminolevulinate dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    779632 (alad)
Enzymes [BR:xtr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     779632 (alad)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   779632 (alad)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 330 aa AA seqDB search
MQVSAILHSGYFHPVLRAWQCSATSLDANNLMYPIFITDNPDAIEEIPSLPGQARYGVNQ
LEGLLRPLVDNGLKCVLIFGVPSKVIKDERGSAADAPDTPAILAIQRIREKFPQLLIACD
VCLCPYTSHGHCGILREDGSLQNESSCQRLAEVALAYARAGCHIVAPSDMMDGRIGAIKQ
ALVSNDLGNKVSVMSYSAKFASCFYGPFRDAAQSKPAFGDRKCYQLPPGARGLAIRAVDR
DVREGADMLMVKPGMPYLDLVREVKEKHPALPLAVYHVSGEYAMLWHGAQANAFDLKVAV
LEAMTGFRRAGADIIITYYTPQLLQWIKER
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcagcgccatcctacacagcgggtatttccaccctgttctgcgggcctggcag
tgctctgctaccagcctcgatgccaacaacctcatgtaccccatcttcatcacggataac
ccggatgccatagaggagattcccagcctgcccggccaagccaggtacggggtgaaccaa
ctggaggggttgctgcgccccctagtggacaatgggctgaagtgcgtgctgatcttcggg
gtcccaagcaaagtcattaaggacgagcggggctccgcggcagacgcgcccgacacgccg
gccatattggccatacagaggattcgggagaagttcccccagctgctcattgcctgtgac
gtgtgcctttgtccctatacctcccacggccactgcgggatcctacgggaagatggcagc
ctacagaacgagagcagttgccagagactggcagaggtggcccttgcttatgcccgtgca
ggctgtcacatcgtggcgccgtcggacatgatggacgggcgaatcggtgccatcaagcag
gcgctggtctccaacgacctgggaaacaaggtgtccgtcatgagttacagcgccaagttt
gcctcctgtttctatgggcccttcagggacgccgcgcagtccaaaccggcctttggtgat
cggaaatgttaccagctcccccccggcgccagaggcttggccatccgggcagtggaccgg
gatgtgcgggaaggggcagatatgctgatggtgaagcccgggatgccctacctggacctg
gtcagagaagtgaaggagaagcaccctgctctcccattggctgtgtaccacgtgtcgggg
gagtacgccatgctgtggcacggggcgcaggccaacgcttttgacctcaaggtggccgtg
ctggaagcaatgacgggattccggagagccggagccgatatcatcatcacgtactacacc
ccccaactcctccagtggataaaggaacgataa

DBGET integrated database retrieval system