KEGG   Xenopus tropicalis (western clawed frog): 779664Help
Entry
779664            CDS       T01011                                 

Gene name
cacng8
Definition
calcium channel, voltage-dependent, gamma subunit 8
Orthology
K04873  
voltage-dependent calcium channel gamma-8
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    779664 (cacng8)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    779664 (cacng8)
   04261 Adrenergic signaling in cardiomyocytes
    779664 (cacng8)
Ion channels [BR:xtr04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN gamma
   779664 (cacng8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 353 aa AA seqDB search
MESWKRWNEGRMVWCEKGVQILLTTVGAFAAFGLMTIAIGTDYWLYARAFICNTTNISSE
ETPQKDKKDPGGLTHSGLWRICCLEGQKRGICVKINHFPEDTDYDHDSAEYLLRVVRASS
IFPILSAMLLLLGGLCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVYISANAGDPG
TKRDDEKKSHYSYGWSFYFGGLSFIIAEMIGVLAVNIYIEKNREAHCKSRTELIKNPSAI
LRLPSYRFRYRRRSRSSSRSTEPSQSRDTSPVGVKGIPSTDISMYTLSRDTSKANVSSLY
NTERGDHSFLQLHNCFPKDSGVTVTVTGPASNTGTLGKDGSNTNTLNRKTTPV
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
ctggagtcgtggaagaggtggaatgagggcagaatggtgtggtgtgagaaaggggtccag
attcttctgaccacagtgggagcttttgctgcttttgggcttatgacaatcgccatagga
acagattactggctttatgccagagccttcatctgcaataccaccaacatctctagtgag
gaaacaccacagaaggacaaaaaggatcctggagggctgactcattctggcctatggaga
atctgctgcttggaaggccaaaagagaggcatttgtgtaaaaatcaatcactttccagaa
gacacagactacgatcacgacagtgctgaatatcttctgcgtgttgttcgtgcttcaagc
atcttcccaatcctcagtgccatgctcctcttactcgggggcctttgcgttgctgccagt
cgtgtttacaagtccaagcgcaacattatcttgggggctggcatcctattcgttgctgca
ggtttaagcaacattattggtgtgattgtttacatttctgcaaatgcgggagatcctggg
acaaagagggatgatgagaagaaaagtcattactcatatggctggtctttctacttcggg
gggctttcttttatcatcgctgagatgattggcgttttagcagtaaatatctacattgag
aagaacagagaggctcattgtaaatcacgcacagagctgatcaaaaatccttcggccatt
ctacgcctaccaagctatcgttttcgatatcgccgacgctcaagatctagttcacgctct
actgaaccttctcagtcaagggacacttctcctgtaggtgttaaagggataccttcaact
gacatctccatgtacaccctgtcaagagatacctcgaaagccaatgtaagcagcctgtat
aacactgagcgtggggatcacagttttctacaacttcacaactgctttcccaaggattcc
ggggtcaccgtcaccgtcacaggaccagcctcaaatacgggcaccctgggcaaggatggt
tccaacaccaacactttaaacaggaaaaccacacctgtgtag

DBGET integrated database retrieval system