KEGG   Xenopus tropicalis (western clawed frog): 779723Help
Entry
779723            CDS       T01011                                 

Gene name
galc, GALCERase
Definition
galactosylceramidase (EC:3.2.1.46)
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    779723 (galc)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    779723 (galc)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     779723 (galc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 678 aa AA seqDB search
MRTVLAGSRRAPGCGEGMFILWLVLLLFPGAPAQYSVDDLGGLGRMFDGIGAISGGGATS
RLLVNYPEPQRTEILDYLFKPNFGASLHIFKVEIGGDAQTTDGTEPSHMHYPDDQNYFRG
YEWWLMKEAKKRNPAIKLIGLPWAFPGWIGNGKNWPYDFPDVTAYYVVSWIIGAKQYHNL
DIDYIGIWNERAYDIKYIKLLRYTLDKNNLEHVKIIASDNLWQPIAFHMLQDPELLRVVD
VIGAHYPGTHAAQDAILTGKTLWASEDYSTYNDEVGGGCWARILNQNYVNGNMTSTISWN
MVASYYEQLPFGLEGLMTAKEPWSGNYVVSTPIWITAHTTQFTQPGWYYLKTVGHLDKGG
SYVALTDRLGNLTIVIETMSHNNSICIRPPLPDYNVSAQYATFYLQGSFKNLQELQVWYS
SLDINNTKPVTFKKLSPLKVQNGSFTLQLGVNEVYTITTLLTGQKGSFPDPPESKPFPLK
YKDDFSVRNPPFSEAPYFADQSGVFEYFTNTSDPGDHVFTFRQVLTQRPITWASDANQAI
SVIGNYQWSNVTVTSDIYIETPDTGGVFVAARVDQGGSPTDRAKGIFFWVFADGTYKVTG
DLMGQTILCKGLAGVRARSWHTLTLHIDGTNAFGLLNGNPLWKEVVTGGPLNGWAAIGTS
CFEFAQFDNFMIEVKDSE
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgaggacggtgcttgctggttccaggagggctccgggctgtggtgaaggcatgtttatt
ctgtggctggtattgctgttgttcccaggagccccagcccagtattcagtagatgatctc
ggagggcttggtcgtatgttcgatgggatcggagcaatcagcggaggaggagcaacgtct
cggcttcttgtaaactacccagaaccacaaagaactgagatcctggattacttgttcaag
ccaaattttggtgcctctttgcacatcttcaaggttgaaattggaggtgacgcacaaaca
acagacggaactgaaccatctcatatgcactaccccgatgatcagaactacttccgaggt
tatgaatggtggttgatgaaagaggcaaagaagagaaaccctgcaataaaactcataggt
ttgccttgggcttttcctggctggattggtaatggcaaaaactggccttacgattttcct
gatgtgacggcttattatgttgtgtcatggattataggtgccaagcaatatcataacttg
gatatcgactacattgggatttggaatgagagagcctatgacataaaatacataaagctt
ttgcgctacacgttggataaaaacaatttggagcatgtgaagataatagccagcgataac
ctatggcaacccatcgcctttcatatgctacaggatcctgagctgctcagggtggtcgat
gttataggtgcccactatcctggaacccacgcagcacaggatgctattctgacagggaag
actctctgggcctctgaagattacagcacttacaatgatgaggtcggtggaggttgttgg
gctcggattctaaaccaaaactatgtgaatggaaacatgacttcgactatctcttggaat
atggtggccagttactatgaacagttaccttttggtttggaagggctgatgactgccaag
gagccatggagtggaaattatgtggtatcaacacccatatggatcactgcacacactacc
cagttcacgcagccaggctggtactatctcaaaacggttggacatttagacaaaggtgga
agctacgtggcactgactgaccggttgggaaacctgacgattgtcattgagaccatgtca
cacaacaactctatctgcatccgtcctccactgccagactataatgtttcagctcagtat
gctacgttctaccttcaaggctcctttaaaaacctgcaagaactgcaggtttggtattca
agtctggacatcaacaacaccaaacctgttacattcaaaaaactgtctccactaaaggta
caaaatggttctttcacattgcagctgggggtgaatgaagtttacacaataacaaccctg
ttgactggacagaagggttcatttcctgatccacctgaatccaaacctttccctctaaaa
tacaaggatgacttcagtgtcagaaacccccccttctcagaggccccttattttgcagat
cagtctggtgtatttgaatatttcacaaatacttctgacccaggcgatcatgtcttcacc
tttcgccaagttctcactcaacgtcctattacttgggcatcggatgctaaccaagccatt
agtgtgattggtaactaccaatggtctaatgttacagtgacaagtgacatttacattgaa
accccggacaccggaggggtgtttgttgctgctagagtggatcagggaggctcaccgact
gaccgggcaaagggtatatttttctgggtgtttgctgatggcacatataaagtcactggg
gatttaatgggccagactattctgtgcaaggggctggcaggtgttcgtgctagaagctgg
catacactgaccctacatattgatggtactaatgcatttgggctgctaaatggaaatccc
ttgtggaaagaagttgtgactggaggacctttgaatggctgggctgccattgggacaagc
tgctttgaatttgcacagtttgataactttatgattgaggtcaaagattctgagtga

DBGET integrated database retrieval system