KEGG   Xenopus tropicalis (western clawed frog): 779727Help
Entry
779727            CDS       T01011                                 

Gene name
kat5, cpla2, esa1, htatip, htatip1, plip, tip60
Definition
K(lysine) acetyltransferase 5 (EC:2.3.1.48)
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     779727 (kat5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 506 aa AA seqDB search
MAEAEIVEGCRLPVLRKNQDNEVEWPLAEILSIKELTGKKLFYVHYIDFNKRLDEWVTHD
RLDLKKIQFPKKEAKTPTKNGLPGSRPSSPEREVRKIPELIPPPVVPPAAGGKSLPVPKR
KVDIVSPATPVPPPPETTQVTVFPQQAPCDVAGVSAHTVMLSQNGAVRRPSAPAVQPGRK
RKSNCLSADEDSQDSSDGIPSAPRMTGSLVSDRSHDDIITRMKNIECIELGRHRLKPWYF
SPYPQELTVLPVLYLCEFCLKYVKSLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGR
KNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYIMTEYDCKGFHIVGYFSKEKESTEDYNV
ACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILM
ELKTETGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVEGHEKA
MQKRVLRIDSKCLHFTPKDWSKRGKW
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcagagattgtggagggttgccgattgcctgtacttcgcaagaatcaagat
aatgaagttgaatggccacttgctgaaattctgagcatcaaggaacttacagggaagaaa
ctattctatgtgcattatatagactttaacaagcgattagatgagtgggttactcatgat
cgtttggatcttaagaagattcaatttccaaagaaagaggcaaaaactccaacaaagaat
ggactacctggatcaagaccaagctcccctgagagagaggtgaggaagattcccgagttg
atcccacctccggttgttccccccgcagcaggtggaaaatctcttcctgtgccgaagcgg
aaggtggacattgtatctcctgcaactccagtcccaccacctccagagacaacccaggtc
actgtctttccacagcaggcgccctgtgatgtagctggagtgagtgcacatacagtgatg
ctgtctcaaaatggtgcagtgcgcagacccagtgctcctgcagtgcaacctggacgcaag
cgcaaatctaactgtctgagtgcagatgaggattcccaggacagctctgatgggattcct
tctgcacctcgtatgacagggagcttggtgtctgaccgcagccatgatgacatcattaca
cgaatgaaaaatattgagtgcattgagcttggtcggcaccgcctcaagccttggtatttc
tcaccataccctcaggagctaacagtattgcctgtcctctatttatgtgaattttgcctg
aaatatgtgaagagtcttaaatgtctacaaaggcacctgacaaaatgtaacctacgccac
cctccaggaaatgagatctacaggaaaggaacaatctccttctttgagatagatgggcgc
aaaaacaagagttactcccagaatctgtgtcttttagcaaagtgctttctggaccacaaa
acattatattatgacactgaccctttcctcttctacatcatgacagagtatgactgcaaa
ggttttcacattgttggttacttttccaaggagaaagaatccacagaagattacaatgtg
gcctgtatcctaaccctgcctccttaccaaagaagaggttatggcaaactgcttattgaa
ttcagttatgagctgtctaaagttgaagggaaaactggaacaccagagaaaccactatca
gatcttgggctgctttcctatcgaagctactggtcacagacaatcctggagattctaatg
gaacttaaaacagaaactggagagaggcctcaaattaccataaatgaaatcagtgagatc
acaagcataaaaaaagaagatgtcatctccacattacagtatttgaacctgatcaattac
tacaagggccagtacatcttgacactttcagaagatattgtggaaggccatgaaaaagct
atgcagaaaagagttttgaggatagactccaaatgtttgcactttacacccaaagactgg
agcaagagggggaaatggtag

DBGET integrated database retrieval system