KEGG   Xenopus tropicalis (western clawed frog): 779733Help
Entry
779733            CDS       T01011                                 

Gene name
dyrk1a, dyrk, dyrk1, hp86, mnb, mnbh
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A (EC:2.7.12.1)
Orthology
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     779733 (dyrk1a)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   779733 (dyrk1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 751 aa AA seqDB search
MHTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMSHSHQQYSDRRQQNLNDQQASALPYN
DQIQQPLPNQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGDDSS
HKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRAEQEWVAIK
IIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEMLSYNLYDL
LRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDF
GSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVD
QMSKIVEVLGIPPAHILDQAPKARKFFEKMPEGTWNLKKTKDGKKEYKPPGTRKLHNLLG
VETGGPGGRRGGESGHTVADYLKFKDLILRMLDYDAKTRIQPYYALQHSFFKKTADEGTN
TSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGGHFTAAVQA
MDCETHSPQVRQQFPPGWTVPEAPTQVTIETHPVQETTFHVPSSQQNVPHHHGNGSHHHH
HHHHHHHGQHVLSNRTRTRIYNSPSTSSSTQDSMDVGHSHHSMTSLSSSTTSSSTSSSST
GNQGNQAYQNRPVAANTLDFGQNGTMDVNLTAFSNPRQETGITGHPDYQYSANTGPGHYV
TEGHLTMRQGMDREDSPMTGVCVQQSPVASS
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaggaggagagacttcagcatgcaaaccatcatctgtccggcttgcaccatcc
ttttcattccatgctgccggccttcagatggctggacaaatgtcccattcacatcagcag
tacagtgaccgccgtcagcagaacctaaacgaccaacaagcatctgccttaccgtataat
gaccagattcagcaaccgttgcccaaccagcggcggatgccacaaacatttcgtgatccg
gccacagcaccattaagaaaactgtcagtcgacttgatcaaaacatacaaacatattaat
gaggtctactatgcaaaaaagaaacggcggcatcagcaaggacaaggggatgactccagt
cacaagaaggagaggaaggtttacaacgatggctatgatgatgacaactacgactatatc
gttaagaatggggaaaaatggatggatagatatgaaatcgattctttaattggcaaaggt
tcattcggccaggttgtaaaggcatatgatcgcgcggagcaagagtgggtggcaattaaa
atcataaagaacaagaaagctttcctaaaccaagcccaaattgaagtacggcttctcgag
ctgatgaacaaacatgacacggaaatgaagtactatattgtgcatttgaagcggcatttt
atgttcagaaaccacctttgtttagtgttcgaaatgctctcgtacaacctctacgactta
ctgcgcaacaccaatttccgcggcgtttcgctcaacctgacacgaaagtttgcacagcag
atgtgcactgcactactcttcctggcgactccagaacttagtatcattcactgtgacctg
aagcctgagaatatcttgctttgtaacccaaaacgaagcgccattaagattgtggacttt
ggaagctcgtgccagctagggcagaggatataccagtatattcagagtcgcttctaccgg
tctcctgaggttttactaggaatgccttatgaccttgcaattgacatgtggtcccttggc
tgcattttggtagaaatgcacactggggagcccctcttcagtggagccaatgaggttgat
caaatgagtaaaattgtggaagttttaggaataccacctgctcacatccttgaccaagca
ccaaaagctagaaagttctttgagaagatgccagaaggcacttggaacttaaagaagacc
aaagatggaaaaaaggagtacaaaccaccgggaacccgaaaacttcacaacctacttgga
gtagaaactggaggaccaggtggccgccgaggcggggaatcaggtcatactgtagcggac
tacttgaagtttaaagacctcattttaaggatgttggattatgatgccaagacccgtatc
caaccctattatgctctgcaacatagtttctttaagaaaactgctgacgaaggtacaaac
acgagtaacagtgtatcaacgagtccagcaatggagcagtcccagtcatcaggaaccacc
tctagcacatcttctagctcgggtggctcgtctggtacaagcaacagtggaagagcaagg
tctgaccctactcatcaacatcgacacagtggtggccatttcacagctgctgttcaggct
atggattgtgagacgcacagtcctcaggttcgacaacagtttcctcctggttggaccgtc
cctgaagcccctacgcaggtcaccattgaaacacaccctgtccaagaaacaacatttcat
gtcccctcttcccagcaaaatgtaccgcatcaccatgggaatggctcccaccaccatcac
caccaccatcatcaccaccacggacagcatgtcttgagtaacaggacgaggaccaggatc
tacaattctccatcaactagctcctccacccaggattctatggatgtcggtcacagccac
cactccatgacatccttgtcttcctcaactacttcttcctcaacatcttcctcttctact
ggcaaccaaggcaatcaggcctaccagaatcgtcctgtggctgctaacaccttggacttt
ggacagaatggaactatggatgttaatttaactgccttttcaaaccctcgccaagagact
ggcatcactggacatccagattaccaatattctgcaaatacaggccccggccactacgta
acggaaggacacttaacgatgaggcaagggatggaccgagaagactctcccatgacagga
gtttgtgttcagcagagtcctgtggcaagctcgtga

DBGET integrated database retrieval system