KEGG   Xenopus tropicalis (western clawed frog): 779785Help
Entry
779785            CDS       T01011                                 

Gene name
mapk7, bmk1, erk4, erk5, prkm7
Definition
mitogen-activated protein kinase 7 (EC:2.7.1.-)
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Gap junction
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    779785 (mapk7)
 Cellular Processes
  Cell communication
   04540 Gap junction
    779785 (mapk7)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    779785 (mapk7)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     779785 (mapk7)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   779785 (mapk7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 925 aa AA seqDB search
MAEPRKEPEEVPDGSGTKLDPGGSTSMPAKGFSILKERSFDVNFEVGDEYEIIETIGVGA
YGVVSSARRKGCGQRVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDILKPSV
PYNDFRSVYVVLDLMESDLHQIIHSSQPLTLEHARYFLYQLLRGLKYIHSANVLHRDLKP
SNLLINENCELKIGDFGMARGLCTKPDEYKYFMTEYVATRWYRPPELMLSLHEYTQAIDM
WSVGCIFAEMLGRKPLFPGKNYLHQLHLIMTVLGTPSSQVIRAIGAERVRAYIQSLPSRQ
PVPWATLYPQAGKKALDLLSKMLRFDPRDRISVAEALRHPFLSKYHDPDDEPECIPAFDF
GFDKKILTKDQIKEAITAEIDGFHRRREGIRRQISFKPALRPAVEGPIGDGPIQEDAFQS
PPLPPPTEGLDIEMPSANSARDKADFPMESPRVPENTETIDLTSPVEKEETEVLGDDHEG
KEETLVVKAEPEPLPKREGAISEDTKAALKAALLKSALRNKSKDAPTSVPEVPETRKPVT
AQERQREREEKRRRRHERAREREKKQKEKERREVKKIEGFGGLVLSENDKNLLERWSRMV
DQTQLQPAVPPAQITGPGHANSAVNICTVAQPLQQSVFGVANLAPLIEVGRQQNGTIAAP
AVPPTIQFIPRCLNPCAVTNLLHYVPPSSAGFQISSVMLTAQAKQDSNPIAAQLPADVSF
VSRGQVLTNNFPTPPRMNPPWPRCVAQEGWSGANRVDCKSVDTSLFLHKPPDLQQPQGGV
PGLAYSNGSVFQNPEQHKSFPPLPPTSYSSANAPQATSPDINLVTQQLSKSQVEDILPPV
FSVTPKGSGAGYGVGFDLEEFLNQSFDMAAENRESHVDSAPLSASLLADWLDIHSMNPAD
MASLQEDLQLGSPMSLSDIPDLQDT
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atggcggagccaaggaaagagccagaggaggtaccagatggatcgggcaccaaactggac
ccaggtggcagcacctccatgccagccaagggcttctccatactcaaagagcgctccttc
gacgtcaacttcgaagttggggacgagtacgagatcatcgaaaccatcggcgtcggcgct
tacggggtggtgtcctcggccaggcggaaaggctgtgggcaaagggtcgccattaagaaa
atccccaacgccttcgacgtggttacgaacgccaagcgcaccctgcgggaacttaagatc
ctgaagcatttcaagcacgacaacatcattgccataaaggacatcttaaagccgtctgtg
ccttacaacgacttcagatctgtatatgtggtgttggaccttatggagagcgatttgcac
caaatcatccactcgtcgcagccacttaccctcgaacacgcccgctacttcctctaccag
cttctgcgcggcctgaaatacatccactcggccaatgttttgcaccgggacctgaagccc
agcaaccttctgattaacgagaactgtgagctgaagatcggggatttcggaatggcccgg
gggctctgcaccaagccggacgagtacaagtatttcatgactgagtatgtggccactcgg
tggtatcggccccctgaactgatgttgtctctccacgagtacacgcaggccattgatatg
tggtccgtagggtgcatatttgctgaaatgttgggacgtaagcctctctttccaggcaaa
aactacctccaccagctacatctcatcatgactgtgctgggcacaccctccagtcaggtg
atccgagccattggggcggagagagtgagggcttatatccaaagtcttccctcgcgccaa
ccagtgccttgggcaaccctctacccccaagctggcaagaaggctctggatctgctgtca
aaaatgctacgttttgacccacgtgaccgcatttccgtagcagaggcacttcggcaccct
ttcctgtccaaatatcacgaccccgacgacgaaccagaatgcatcccggcctttgatttt
ggattcgataaaaagattctcacaaaggaccaaataaaagaggctataacggcggagata
gacggctttcaccgtagaagggagggcatacgacggcagatcagctttaaaccagcactc
agaccagccgtggaagggcccatcggggacggacctattcaagaagatgccttccaatcg
ccaccactacccccacccaccgagggattggatatagagatgcccagtgccaattcggct
cgggacaaggcagatttcccaatggagtctccccgggttccagagaacacagagaccatc
gatctcacctctcctgtggagaaggaagagacagaggtgctgggggacgatcatgaaggc
aaagaagaaaccctagtggttaaagctgaaccggagcccttgccaaagcgagaaggggca
atatcggaggatactaaagcagcgcttaaggccgctctcttgaagtcagctttacggaac
aagagtaaagatgcacccacttccgtccctgaggttcccgaaacccggaaaccagtcacg
gctcaggagcgacagcgggagcgggaggagaagcgaaggcggcgccacgaacgcgccagg
gagcgggagaaaaagcagaaagagaaggagcgtcgggaagtgaagaagatagaaggcttc
ggaggcctggtgctgagcgagaacgataagaatttgttggaacgctggagtcgaatggtc
gaccagacccagctgcagccggccgttcctcctgctcagataaccgggcccggtcatgcc
aattcagccgttaacatttgcactgtggctcagccgctgcagcagtctgtgtttggtgtg
gccaacttagctcctcttatagaggttgggaggcaacagaacggtactattgctgctcca
gcggtaccgcctaccatccagttcattccgaggtgtctgaacccttgcgccgtgaccaac
ctgctccattatgtcccgccctcctctgcgggctttcagattagttccgttatgctgacc
gcccaagcgaagcaagactccaatcccatagctgcccagctgccggccgatgtctcgttc
gttagcagaggacaagtcctgaccaataactttcctacgcccccacgaatgaatccccct
tggccccggtgtgtagctcaggagggctggtctggggcaaacagagtggattgcaagagc
gtggacacttccctcttcctccataagccccccgacctccaacagccacagggaggagtc
ccaggacttgcatattctaatggatccgtcttccagaacccggaacagcacaaaagtttc
ccacctcttccgcccacgtcgtacagcagcgccaacgccccccaggcaacatctccagac
atcaacttggtgactcagcaactttccaaatcccaggttgaagatatccttcctccagtt
ttctcggtcactccgaaaggaagtggagccgggtacggagtggggttcgatctggaagaa
tttctcaatcagtcctttgatatggcagcagagaaccgggaaagccacgtggactccgcc
cccctttctgcgtcgctactggccgactggctggacattcacagcatgaacccggcggac
atggcttccctacaggaggatctgcagctgggctcccccatgagtctctccgacatcccc
gacctacaggacacctaa

DBGET integrated database retrieval system