KEGG   Xenopus tropicalis (western clawed frog): 779799Help
Entry
779799            CDS       T01011                                 

Gene name
tesk2
Definition
testis-specific kinase 2 (EC:2.7.12.1)
Orthology
K08842  
testis-specific kinase 2 [EC:2.7.12.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     779799 (tesk2)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: TKL group
  LISK family [OT]
   779799 (tesk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 615 aa AA seqDB search
MDRNKRNSIAGFPPRLERIEDGGRDGGITQLGRVYTSSYSALISAFSRLTRLDDFTCEKI
GSGFFSEVFKVRHRTSDQVMALKMNKLSSNRANMLKEVQLMNRLSHPNILRFMGVCVHQG
QLHALTENCLIKSDESGYSAVVADFGLAEKIPDYSEGSEKLAVVGSPYWMAPEVLRDEPY
DEKADVFSYGIILCEIIARIQADPDYLPRTENFGLDYDGFQHMVGDCPPDFLQLTFNCCN
MDPKLRPSFIDIAKQLENILNRLRNEEAERERKDLSENNIEPKPISLAKGPNDKCQGVKR
LISMVPQDDKIPQKSPRPRRNITLSRSQSDIFARKPLRKVNVQDPFYTPSKGAVRKVNPF
SAREDLKGRIKFFDMPSKSVISHVFDLHSPKRDGSLAAGTSGQIRQLLSQDIVDFSIIPR
RRCRSLPVSPELLRKDCTSSGLSCTVGKFDPAQLGSEVRQKLLSSVKYSVQDIPPFRPRS
PEYLQANDEDMDCTDATFTQEANGFCPGRTENKVQAYYNQLLVSNKKHAHCSQKSLNSYS
EEENSFDLFSSSEAMEIEEETSQNLSTALSASSISFSSPTRVGGVTLLPLENTVADSKDS
PSLSSCRILQSTVKM
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggacaggaataagcgcaactctatagctggatttcctcctcgtctggagcgcattgaa
gatggtggaagagatggaggcataactcagttgggaagggtttatacatcatcctacagc
gctctcattagtgccttctcccgattaacacgactcgatgacttcacttgtgaaaaaatt
ggctctggattcttctctgaggttttcaaggtgcgccacaggacatctgatcaagttatg
gctttgaagatgaacaaactcagcagtaatcgagccaatatgctgaaggaggtgcagctt
atgaatcgtttgtcccatcccaatatcttaaggttcatgggagtatgtgttcaccaaggg
caattgcatgctctcactgagaactgtttgataaagagtgatgaaagcggatattctgct
gtagtggcagattttgggctggcagaaaaaatcccagattacagtgagggaagtgagaag
cttgctgttgttgggtcaccttactggatggccccagaagttctgagagatgaaccctat
gatgaaaaggcagatgtgttctcctatggtataatcctttgtgaaataatagcccggata
caagcagaccctgattatctgccacgcacagagaattttggcttggactacgatggcttc
cagcacatggtgggagactgcccccctgacttccttcagctcacattcaactgctgcaat
atggacccaaaactccgtccttcctttatagatattgcaaagcagcttgagaacattcta
aatcgtttaagaaatgaggaggcagaaagggagagaaaagatctgagtgagaataacata
gagcccaaacccatctctctcgctaaagggcccaatgacaaatgccagggggtaaagcgc
ctgatttctatggtgcctcaggatgacaaaattcctcagaagtccccacgccccagaaga
aacattactttatcccgcagccagtctgatatatttgcacgtaagccactgcggaaggtc
aatgtgcaggacccattctacactcccagcaagggagctgtgcgcaaagttaatcccttt
agtgccagggaagacttaaaaggaaggatcaaattctttgacatgcctagcaaatctgtt
atttctcatgtgtttgatttacattcacccaaaagagatgggtctctggcggcaggaaca
agtggacagataaggcagctattaagtcaggacatcgtggacttctctatcattccccga
agacgttgcagatccttgccggtatctcctgagcttcttagaaaggattgcacaagttca
gggctctcctgtactgttggcaaatttgatcctgcacaacttgggtctgaggtacgacag
aagctcctctcaagtgtcaagtatagtgtacaggatatacctccatttaggccaagatct
ccagagtatttgcaggcaaatgatgaggatatggattgcaccgatgcaactttcacacag
gaagcaaatggcttttgccctggcagaactgagaataaagtgcaggcgtactataaccag
ctgctggtcagtaataaaaagcatgcacactgctctcaaaagtcgcttaattcatattct
gaggaggagaactcctttgatttgttctcgagctctgaagctatggaaatcgaggaggaa
acgagccagaatctttccactgctttgtcggcctcctctatcagctttagtagcccaacc
agggttggaggtgtcacgttgctacctttagagaatactgttgcagatagcaaggactct
ccctctttgtccagctgcaggattctgcaaagcactgttaaaatgtga

DBGET integrated database retrieval system