KEGG   Xenopus tropicalis (western clawed frog): 779840Help
Entry
779840            CDS       T01011                                 

Gene name
flna
Definition
filamin A, alpha
Orthology
K04437  
filamin
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xtr04010]
Cellular Processes; Cell communication; Focal adhesion [PATH:xtr04510]
Human Diseases; Infectious diseases; Salmonella infection [PATH:xtr05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 217 aa AA seqDB search
MVSAYGPGLEGGTTGSAAEFIVNTTKAGPGALTVTIDGPSKVKMDCQECAEGYKVTYTPM
APGSYLISIKYGGPYHIVGSPFKAKVTGPRLVTSHSLHESSSVFVDSVTKSEAFTQHAAA
PRIASDASKVVAKGLGLNKAFVGQKNSFTVDCSKAGNNMLLVGVHGPKTPCEEIVVKHLG
NRLYNVTYLLKDKGDYILVVKWGDEHILGSPYHVSVP
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggtatctgcatatggccctgggttagaaggaggcaccacaggcagtgctgcagagttc
attgtcaacaccacaaaagcaggccctggggcactcacagtcacaattgatggcccgtcc
aaagtcaaaatggactgccaggaatgtgccgagggctataaggtcacctacactcctatg
gctcctggaagctacctgatatccatcaagtacgggggaccctaccatattgtgggaagc
ccattcaaagcaaaggttacaggtcctcgcctagtgaccagccacagcctacatgaatcc
tcttcagtctttgttgattctgtcaccaaatctgaggccttcactcagcatgccgcagct
cctaggatagcatcagacgccagcaaagtagtggccaaagggctaggactcaacaaagcc
tttgtaggccagaagaactctttcactgtggactgcagtaaagctggtaacaacatgctg
cttgtcggagttcatggaccgaaaaccccatgtgaagagatagtggtgaagcaccttggg
aaccgtctctacaacgttacgtacctcctgaaggataagggggattacatccttgtagta
aaatggggcgatgagcacattctgggaagcccttaccatgtgtctgtgccttaa

DBGET integrated database retrieval system