KEGG   Xenopus tropicalis (western clawed frog): 779840Help
Entry
779840            CDS       T01011                                 

Gene name
flna
Definition
(RefSeq) filamin A
  KO
K04437  
filamin
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    779840 (flna)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    779840 (flna)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    779840 (flna)
Cytoskeleton proteins [BR:xtr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     779840 (flna)
  Intermediate filaments
   Intermediate filament-binding proteins
    779840 (flna)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   779840 (flna)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
Position
8
AA seq 217 aa AA seqDB search
MVSAYGPGLEGGTTGSAAEFIVNTTKAGPGALTVTIDGPSKVKMDCQECAEGYKVTYTPM
APGSYLISIKYGGPYHIVGSPFKAKVTGPRLVTSHSLHESSSVFVDSVTKSEAFTQHAAA
PRIASDASKVVAKGLGLNKAFVGQKNSFTVDCSKAGNNMLLVGVHGPKTPCEEIVVKHLG
NRLYNVTYLLKDKGDYILVVKWGDEHILGSPYHVSVP
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggtatctgcatatggccctgggttagaaggaggcaccacaggcagtgctgcagagttc
attgtcaacaccacaaaagcaggccctggggcactcacagtcacaattgatggcccgtcc
aaagtcaaaatggactgccaggaatgtgccgagggctataaggtcacctacactcctatg
gctcctggaagctacctgatatccatcaagtacgggggaccctaccatattgtgggaagc
ccattcaaagcaaaggttacaggtcctcgcctagtgaccagccacagcctacatgaatcc
tcttcagtctttgttgattctgtcaccaaatctgaggccttcactcagcatgccgcagct
cctaggatagcatcagacgccagcaaagtagtggccaaagggctaggactcaacaaagcc
tttgtaggccagaagaactctttcactgtggactgcagtaaagctggtaacaacatgctg
cttgtcggagttcatggaccgaaaaccccatgtgaagagatagtggtgaagcaccttggg
aaccgtctctacaacgttacgtacctcctgaaggataagggggattacatccttgtagta
aaatggggcgatgagcacattctgggaagcccttaccatgtgtctgtgccttaa

DBGET integrated database retrieval system