KEGG   Xenopus tropicalis (western clawed frog): 779840Help
Entry
779840            CDS       T01011                                 

Gene name
flna
Definition
filamin A, alpha
Orthology
K04437  
filamin
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    779840 (flna)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    779840 (flna)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    779840 (flna)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   779840 (flna)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 217 aa AA seqDB search
MVSAYGPGLEGGTTGSAAEFIVNTTKAGPGALTVTIDGPSKVKMDCQECAEGYKVTYTPM
APGSYLISIKYGGPYHIVGSPFKAKVTGPRLVTSHSLHESSSVFVDSVTKSEAFTQHAAA
PRIASDASKVVAKGLGLNKAFVGQKNSFTVDCSKAGNNMLLVGVHGPKTPCEEIVVKHLG
NRLYNVTYLLKDKGDYILVVKWGDEHILGSPYHVSVP
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggtatctgcatatggccctgggttagaaggaggcaccacaggcagtgctgcagagttc
attgtcaacaccacaaaagcaggccctggggcactcacagtcacaattgatggcccgtcc
aaagtcaaaatggactgccaggaatgtgccgagggctataaggtcacctacactcctatg
gctcctggaagctacctgatatccatcaagtacgggggaccctaccatattgtgggaagc
ccattcaaagcaaaggttacaggtcctcgcctagtgaccagccacagcctacatgaatcc
tcttcagtctttgttgattctgtcaccaaatctgaggccttcactcagcatgccgcagct
cctaggatagcatcagacgccagcaaagtagtggccaaagggctaggactcaacaaagcc
tttgtaggccagaagaactctttcactgtggactgcagtaaagctggtaacaacatgctg
cttgtcggagttcatggaccgaaaaccccatgtgaagagatagtggtgaagcaccttggg
aaccgtctctacaacgttacgtacctcctgaaggataagggggattacatccttgtagta
aaatggggcgatgagcacattctgggaagcccttaccatgtgtctgtgccttaa

DBGET integrated database retrieval system