KEGG   Xenopus tropicalis (western clawed frog): 779843Help
Entry
779843            CDS       T01011                                 

Gene name
usp44
Definition
(RefSeq) ubiquitin specific peptidase 44 (EC:3.4.19.12)
  KO
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.4.19.12]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     779843 (usp44)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   779843 (usp44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 652 aa AA seqDB search
MDKCKHVGRLRLAQDHSILNPQKWHCVDCNTTESVWACLSCSHVACGRYIEEHALRHFQD
SKHPLALEVNELYVFCYLCDDYVLNDNTTGDLKLLRSTLSAIKSQNYDCTTRSGRTLRSM
VTADDSFISHEGAQAFLQNEDRAFTALWHRRHALLGKVFRSWFALTPKGKQRLEEERLRE
VAEQKREEARKRRQQLKRKLKEEMESTPPRKSSRLKQQMQPSPKTELPSVQKMNQKYTPT
TKQKPPAPTSIEVCLKKIGNSPIKRKPTVTPGVTGLRNLGNTCYMNSILQILSHLHVFRE
CFLQLDLNQTQELLAAAGSGKTRLSSKYPPSAVLPKVTQKHTKVQRSLARRQSFSSGLSG
GASNSRNMELIQPKEPSSKHISLCHELHTLFQVMWSGKWALVSPFAMLHSVWRLIPAFRG
YAQQDAQEFLCELLDKVQQELETTGTRYPTLIPASQRKLIKQVLNIVNNIFHGQLLSQVT
CLACDHKSNTIEPFWDLSLEFPERYHFNGKETASQRPCLLTEMLAKFTETEALEGKIYAC
DQCNTKRRKFSSKPVVLTEAQKQLMVCRLPQVLRLHLKRFRWSGRNHREKIGVHVRFDQM
LNMEPYCCRESTAALRADCFIYDLSSVVMHHGKGFGSGHYTAFCYNPEGGNG
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggataaatgtaaacatgttggccgattgcgtctcgcccaagatcattcaattttgaac
cctcaaaagtggcactgtgtggattgcaacactaccgaatccgtgtgggcttgcctaagc
tgttcacatgttgcgtgtggtcgatacattgaagagcatgcactgcgacactttcaggac
agtaagcatcctttggctttggaggttaatgaactttacgttttttgttacctctgtgat
gattatgttctcaatgacaacaccactggtgaccttaaacttttacgaagcacgttaagt
gctatcaaaagtcagaactatgactgtacaacacgtagtggtcggactttgcggtctatg
gtaactgcagatgattcattcatttcacatgaaggtgcacaagcctttcttcaaaatgaa
gaccgtgcattcactgcattgtggcatcggaggcatgctctcttagggaaggtttttagg
tcatggtttgctttgactccaaaaggcaagcaaaggctagaagaggaacgcttgagggag
gtggcagaacagaagcgagaggaagcaaggaaaaggcgacagcagttgaagcgcaaatta
aaggaagaaatggaaagcactccccctagaaaaagttcacgtttgaaacagcaaatgcaa
ccttcccccaaaactgaattgccctctgtgcaaaaaatgaaccaaaaatacactcctacc
acaaaacaaaaaccaccagcacctacctctattgaagtatgcttaaaaaaaattggtaat
tctccaataaaaagaaagcccactgtgacccctggagtaacaggactgaggaatctgggg
aacacctgctacatgaactcaatacttcagatactgagtcatttgcatgttttccgggag
tgttttttgcaacttgatctcaatcaaactcaggagttgttggcagctgctggcagtggg
aaaacaaggttgtccagcaaatacccacctagcgctgtcctaccaaaagtaacacaaaag
cacactaaagttcaaagatcactggcaaggcgtcagagcttctcctcgggacttagtggt
ggggcctcaaatagtagaaacatggaactaattcagcctaaggagccaagttcaaagcac
atatccctatgtcatgaattgcataccctcttccaagtcatgtggtcaggtaaatgggca
ctggtttctccctttgcaatgctacattcagtctggaggcttataccagccttccgtggg
tacgcacaacaagatgctcaggaattcctctgtgaactattggataaagtacaacaagaa
ttggagacaactggcaccagatacccaaccctaattcctgcttctcaaaggaaactcatc
aaacaggtcctgaatatcgtcaacaacatttttcacgggcaactacttagtcaggttact
tgtctggcctgtgatcataaatcaaataccattgagccattttgggacttgtctcttgag
tttcccgagaggtaccacttcaatggcaaagagacagcttctcagcggccttgtctgttg
acagaaatgctggccaaattcacagagactgaagccttagaagggaagatctatgcttgt
gaccagtgcaacacaaagcgtaggaagttctcatccaaaccagttgtccttacagaagca
cagaagcagctgatggtgtgtcggttacctcaggtcctgagactgcacctcaagagattc
cggtggtctggccgaaaccatcgtgagaaaattggagtgcatgttcgctttgaccagatg
ctgaacatggagccttattgttgtagagagtccactgcagccctgagagctgactgcttt
atttatgatctgtcgtctgtcgtgatgcatcatgggaaaggttttggttctggccattac
actgccttttgttacaatccggaaggaggtaatggatag

DBGET integrated database retrieval system