KEGG   Xenopus tropicalis (western clawed frog): 779925Help
Entry
779925            CDS       T01011                                 

Gene name
cdc27
Definition
cell division cycle 27
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Module
APC/C complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:xtr04120]
Cellular Processes; Cell growth and death; Cell cycle [PATH:xtr04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:xtr04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xtr04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 832 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKAHSCATPQCKYLLAKCCVDLSKLAEGEQILSGGVLNKQKSQEEIVTEFGDSACFTLSL
LGHVYCKTDRLAKGAECYQKSLSLNPFLWSPFESLCEIGEKPDPEQTFKLTSLQNFSNCL
PNTCTMTVNTHSVVQHRQPDTVLMETPQDTIELNRLNLESSNMKYPLNSDSSISYIDPGV
ISPDSLPLGTGTSILSKQAQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQ
TYSSCVLDVPSSGAPTKKSVARISQAGTKSVFSQSGNSRDVTPVLLVQTQGSGPQTSTTP
QVLSPTIAAPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKMPNRKTKSKTSKGGVTQ
ANMNDSLEISKLDSSIISEGKISSVAPQIQALTIQKAAAEGLMSLLRDMGKGYVALCSYN
CKEAINILSHLPSHHYNTGWVLCQIGRAYFELAEYLQAERVFSEVRRIESYRVEGMEIYS
TTLWHLQKDVTLSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPGY
AYAFTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQK
ALDINPQSSVLLCHIGVVQHALKKSDKALDTLNKAISIDPKNPLCKFHRASILFANEKYK
LALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAID
KRYLPDDEEAVTQEEQISECYPYESVATDESQESSMTDADDTQLHAAESDEF
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgacagtactgcaggaacccgtccaggctgctatatggcaagcactgaatcactacgca
tacagagatgcagtattcttggcagagaggctctatgcagaagtgcattctgaggaggca
ttatttttgctggccacctgctattaccgctcaggaaaagcttacaaggcataccgtctc
ctgaaagcccacagttgtgccactccacaatgtaaatatcttcttgcaaagtgctgtgtt
gacctcagcaagctagctgagggagagcagatcttgtcgggtggtgtgcttaataaacag
aagagtcaagaggagattgttacagagtttggagactctgcctgctttacattatcattg
cttggccatgtatattgcaaaacagatcgattggctaaaggagcagaatgttaccaaaag
agccttagtttaaatcctttcctgtggtccccatttgagtctctgtgtgaaataggtgaa
aagccagaccctgagcagacattcaaactgacctcactccagaacttcagtaactgcctg
cccaacacttgcacaatgaccgtgaacacacacagtgttgtacaacataggcaacctgat
acagtgttaatggagactcctcaagacactatcgaacttaacagactgaacctggagtca
tctaacatgaaatatcccttgaacagtgattcctcaatatcctacatagatcctggtgtt
atttctcccgattccctgccccttggtactggaacctccattctatccaaacaggcccaa
aacaaaccaaagactggccgcagcctattgggaggaccagcagcactaagcccactcact
ccaagttttggaattctgcctctagaaacccccagccctggagatgggtcatatttacaa
acctactcctcttgtgtccttgatgtgccatcatctggtgccccaacaaaaaagtctgtt
gctagaatcagccaagcaggaacaaagtctgtcttttctcagagcggtaacagccgggat
gtcaccccagttctccttgtacagactcagggctctggtcctcaaacaagcaccacacct
caggtactgagcccaacaatagccgctccacctaatgcattaccacgtcgtagttctcgg
ctttttaccagcgatagctctaccaccaaggaaaacagcaaaaagttaaaaatgaagttt
ccacctaaaatgccaaatcgaaagaccaaaagtaaaacaagtaaaggtggtgtgacacag
gccaacatgaacgacagcttggagattagtaaattggattcctcgattatctctgagggc
aaaatctccagcgttgccccccaaattcaggcacttactattcagaaggcagcagcagaa
ggtttgatgagtctcttaagggatatggggaagggttatgtggctttgtgctcttacaac
tgcaaggaggctataaatatactgagtcatctcccatctcatcactacaacactggctgg
gtcttgtgccagattggccgtgcctattttgagcttgcagagtatcttcaggctgaacga
gtgttctccgaggtgcggagaattgagagctatcgagtagaaggcatggagatctactca
actactttgtggcatttgcagaaggatgtgaccttgtctgtactttccaaggacctgaca
gatatggacaagaactctccagaggcttggtgtgcagctggaaactgcttcagtttacaa
agggaacatgacattgcaataaagttcttccagagggccattcaagtggatccaggttat
gcctacgcgtttactctacttgggcacgagttcgtactgaccgaggagctggacaaagca
ttggcatgtttcagaaatgccatccgagtcaaccccagacactacaatgcctggtatgga
cttggaatgatttactacaagcaagagaagtttagcttggcagaaatgcattttcagaaa
gctctagatattaaccctcagagttctgtattgctgtgtcatattggagtagtgcagcat
gcactcaagaagtctgacaaggctttggacacactaaacaaagccatttccatagacccc
aaaaacccactatgcaagttccatcgagcctctattctctttgccaatgaaaagtacaag
ttggcgctgcaagaattggaggagctgaaacagattgtacctaaggagtccttggtgtac
ttcttaataggaaaggtatacaagaagttgggacagacgcatttggcgctgatgaatttt
tcctgggccatggacttggaccccaaaggtgctaacaatcagatcaaagaggctatagac
aaacggtacctgccagatgatgaggaggcagtgacccaagaggaacagatcagcgagtgt
tacccctatgaatcagtggccactgatgaatcgcaggagagcagtatgacagatgcagat
gacacacagttgcatgctgctgagagtgatgaattttaa

DBGET integrated database retrieval system