KEGG   Xenopus tropicalis (western clawed frog): 779925Help
Entry
779925            CDS       T01011                                 

Gene name
cdc27
Definition
cell division cycle 27
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    779925 (cdc27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    779925 (cdc27)
   04114 Oocyte meiosis
    779925 (cdc27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    779925 (cdc27)
Protein phosphatases and associated proteins [BR:xtr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     779925 (cdc27)
Ubiquitin system [BR:xtr04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     779925 (cdc27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 832 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKAHSCATPQCKYLLAKCCVDLSKLAEGEQILSGGVLNKQKSQEEIVTEFGDSACFTLSL
LGHVYCKTDRLAKGAECYQKSLSLNPFLWSPFESLCEIGEKPDPEQTFKLTSLQNFSNCL
PNTCTMTVNTHSVVQHRQPDTVLMETPQDTIELNRLNLESSNMKYPLNSDSSISYIDPGV
ISPDSLPLGTGTSILSKQAQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQ
TYSSCVLDVPSSGAPTKKSVARISQAGTKSVFSQSGNSRDVTPVLLVQTQGSGPQTSTTP
QVLSPTIAAPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKMPNRKTKSKTSKGGVTQ
ANMNDSLEISKLDSSIISEGKISSVAPQIQALTIQKAAAEGLMSLLRDMGKGYVALCSYN
CKEAINILSHLPSHHYNTGWVLCQIGRAYFELAEYLQAERVFSEVRRIESYRVEGMEIYS
TTLWHLQKDVTLSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPGY
AYAFTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQK
ALDINPQSSVLLCHIGVVQHALKKSDKALDTLNKAISIDPKNPLCKFHRASILFANEKYK
LALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAID
KRYLPDDEEAVTQEEQISECYPYESVATDESQESSMTDADDTQLHAAESDEF
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgacagtactgcaggaacccgtccaggctgctatatggcaagcactgaatcactacgca
tacagagatgcagtattcttggcagagaggctctatgcagaagtgcattctgaggaggca
ttatttttgctggccacctgctattaccgctcaggaaaagcttacaaggcataccgtctc
ctgaaagcccacagttgtgccactccacaatgtaaatatcttcttgcaaagtgctgtgtt
gacctcagcaagctagctgagggagagcagatcttgtcgggtggtgtgcttaataaacag
aagagtcaagaggagattgttacagagtttggagactctgcctgctttacattatcattg
cttggccatgtatattgcaaaacagatcgattggctaaaggagcagaatgttaccaaaag
agccttagtttaaatcctttcctgtggtccccatttgagtctctgtgtgaaataggtgaa
aagccagaccctgagcagacattcaaactgacctcactccagaacttcagtaactgcctg
cccaacacttgcacaatgaccgtgaacacacacagtgttgtacaacataggcaacctgat
acagtgttaatggagactcctcaagacactatcgaacttaacagactgaacctggagtca
tctaacatgaaatatcccttgaacagtgattcctcaatatcctacatagatcctggtgtt
atttctcccgattccctgccccttggtactggaacctccattctatccaaacaggcccaa
aacaaaccaaagactggccgcagcctattgggaggaccagcagcactaagcccactcact
ccaagttttggaattctgcctctagaaacccccagccctggagatgggtcatatttacaa
acctactcctcttgtgtccttgatgtgccatcatctggtgccccaacaaaaaagtctgtt
gctagaatcagccaagcaggaacaaagtctgtcttttctcagagcggtaacagccgggat
gtcaccccagttctccttgtacagactcagggctctggtcctcaaacaagcaccacacct
caggtactgagcccaacaatagccgctccacctaatgcattaccacgtcgtagttctcgg
ctttttaccagcgatagctctaccaccaaggaaaacagcaaaaagttaaaaatgaagttt
ccacctaaaatgccaaatcgaaagaccaaaagtaaaacaagtaaaggtggtgtgacacag
gccaacatgaacgacagcttggagattagtaaattggattcctcgattatctctgagggc
aaaatctccagcgttgccccccaaattcaggcacttactattcagaaggcagcagcagaa
ggtttgatgagtctcttaagggatatggggaagggttatgtggctttgtgctcttacaac
tgcaaggaggctataaatatactgagtcatctcccatctcatcactacaacactggctgg
gtcttgtgccagattggccgtgcctattttgagcttgcagagtatcttcaggctgaacga
gtgttctccgaggtgcggagaattgagagctatcgagtagaaggcatggagatctactca
actactttgtggcatttgcagaaggatgtgaccttgtctgtactttccaaggacctgaca
gatatggacaagaactctccagaggcttggtgtgcagctggaaactgcttcagtttacaa
agggaacatgacattgcaataaagttcttccagagggccattcaagtggatccaggttat
gcctacgcgtttactctacttgggcacgagttcgtactgaccgaggagctggacaaagca
ttggcatgtttcagaaatgccatccgagtcaaccccagacactacaatgcctggtatgga
cttggaatgatttactacaagcaagagaagtttagcttggcagaaatgcattttcagaaa
gctctagatattaaccctcagagttctgtattgctgtgtcatattggagtagtgcagcat
gcactcaagaagtctgacaaggctttggacacactaaacaaagccatttccatagacccc
aaaaacccactatgcaagttccatcgagcctctattctctttgccaatgaaaagtacaag
ttggcgctgcaagaattggaggagctgaaacagattgtacctaaggagtccttggtgtac
ttcttaataggaaaggtatacaagaagttgggacagacgcatttggcgctgatgaatttt
tcctgggccatggacttggaccccaaaggtgctaacaatcagatcaaagaggctatagac
aaacggtacctgccagatgatgaggaggcagtgacccaagaggaacagatcagcgagtgt
tacccctatgaatcagtggccactgatgaatcgcaggagagcagtatgacagatgcagat
gacacacagttgcatgctgctgagagtgatgaattttaa

DBGET integrated database retrieval system