KEGG   Xenopus tropicalis (western clawed frog): 780054Help
Entry
780054            CDS       T01011                                 

Gene name
ttk
Definition
TTK protein kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    780054 (ttk)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     780054 (ttk)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: Other group
  TTK family
   780054 (ttk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 852 aa AA seqDB search
MDDEDISERKLKIASILDRVKSFKTKYGTDDNWTDELTFSKSSADTTEHSGIFTHLVTTK
TPEEWLNYLLKLENTGLPQIDPLLLNKLIDDYSQAVGALSAEKHSHNESYAKILVRFAEL
KAIHDPDEARDQFQLARLNCKKFAFVHTAFAQFELSEGNFKKCKQILRRGLECGALPCEM
LNLALKNLQLKKTQLISEEDKENLAVSSSQINQGMAGYQNLALGNPQRMKNESPEEYSVK
TRFSYGEKLSSPEDFEDIGRKPLLNMPAKSCPLGRVPVQPTTSPDMRTRKSDGSGSSSVV
KKPPSSMRVPVLAALPKPKYLGDDLHCSEDIKLPSRTSPSHEEQANEDSLDIKTPSSVLL
SGTESTLTVKRNEDIIMEDKDSSTAVLNHQENRKPSKPAPPPIPNINARLSDTTKPNNIE
AEWKWKVPETPRHIFQPECKRKSIEPCANPGSRRASPPAPSIRKCDPVFVCRTPVNKMQE
DYMNCFRTPVVKTNLGPLAQMSTPCTNRLDYQHPQTPIVQPGCFPISAPLASSDCIVVKG
RVYAVLKQIGTGGSSKVFQVMDDKKHLYAIKYVNLQEADQQTIESYQNEISHLNKLQQHS
DKIIRLYDYEITDQHIYMVMECGNIDLNTWLRKKKAINPWERKSYWKNMLEAVHTIHQHG
IVHSDLKPANFLIVDGMLKLIDFGIANQIQPDVTSIVKDSQISPKGDVWSLGCILYCMTY
GKTPFQHITNQITKLHAILDPGYEIEFPNIPEKDLQDVLRKCLVRNPKERISIAELLVHP
YVQIQPHTQPDQQVQKETTEEMKRILGQLIGLNSPNSISRAARSLYDQFNSGRSLDLSAL
GTTVNQNTRTMK
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgaagatataagtgaacggaaactgaaaattgcctctatcttggatagagtt
aaaagttttaagaccaagtatggaacagatgataactggactgatgaattaacattttca
aagtcttctgctgacactacagagcactctggcatttttacacacttggttaccacaaag
actcccgaagaatggctaaattatcttctaaaattagagaatacaggcctgcctcagatt
gacccactactgctcaataagttaattgatgattacagtcaagctgttggagccctctct
gcagaaaaacacagtcacaacgagagctatgctaaaatcctggtccgctttgccgaactg
aaagcaatccatgacccagatgaagcacgggatcagttccagcttgcaagactaaactgc
aaaaaatttgcatttgtgcatacagcttttgcccagtttgagctgtcagaaggcaatttt
aaaaagtgtaagcaaattcttcgtagaggtctggaatgtggagctcttccttgtgaaatg
ttgaacttggcgttgaaaaatttacagttaaagaagactcagctgatatccgaagaagat
aaagaaaatttagcagtgtcatcaagtcagatcaatcaaggcatggctggttatcagaat
ttggcattgggaaatccacaaagaatgaagaatgaaagcccagaggaatattctgtaaaa
acaagattttcatatggagaaaagttaagctccccagaagactttgaagatatagggagg
aaacctttgctaaacatgcctgccaagagctgtcctttgggcagagtgcctgtacagcca
acaacatctccagatatgagaacacgcaagagtgatggttctggcagttctagtgtagtg
aagaaaccaccaagttccatgcgtgtgcctgtccttgctgctttgccaaaaccgaaatat
ttgggagatgatcttcattgctctgaagacataaagttaccaagcaggaccagcccatcg
catgaagaacaggctaatgaagacagtttagatataaaaacaccttcatctgttctgctt
agtggcactgaatcaacccttacagtcaaaagaaacgaagatataattatggaagacaaa
gactcttctacagctgttctcaaccatcaagaaaatagaaaaccatccaaaccagctcca
ccacctatacccaacattaacgcaaggctctctgacactactaaaccaaacaatattgag
gcagaatggaagtggaaggttccggagacacccaggcatattttccagccagagtgcaaa
cggaagagtattgaaccatgtgctaatcctggttcccgacgagcttctccaccagcaccc
tctattaggaaatgtgaccctgtctttgtttgtcgaacaccagtgaataaaatgcaagag
gattacatgaattgctttagaactccagttgtaaaaactaacctaggaccattggcacag
atgtccacaccttgtaccaaccgtttagattatcagcacccacagactcctattgtacaa
cctggctgctttccaatttctgcacctcttgcttcaagtgattgtattgtagttaaagga
agagtgtatgcagttttaaaacaaattggaactggtggatctagtaaggtgtttcaagta
atggatgataaaaagcatttatatgcaatcaagtatgtgaatctgcaagaagctgaccag
cagaccatagaaagctatcagaatgaaatttctcacttaaacaaacttcagcaacacagt
gacaagatcattaggctctatgactatgagattacagaccaacatatttacatggtaatg
gagtgtggaaatatagatcttaatacttggctaaggaagaaaaaggctattaatccttgg
gagcgaaagagctactggaaaaatatgcttgaggcagttcacacaatacatcagcatggg
attgtacacagtgacttgaagccagcaaactttttaattgttgacgggatgcttaagcta
atagactttggcatagcaaaccaaatacagccggatgtcaccagcattgttaaagattca
cagattagtccaaaaggtgatgtctggtctctgggttgcatattgtactgcatgacatac
gggaagactccttttcaacatataactaatcagatcactaaacttcatgcaattctggac
cctggttatgaaatagagtttcctaatataccagagaaagacctccaagatgtactaagg
aaatgtttagtacgaaatcctaaggaaaggatatccattgctgagctccttgtgcaccca
tatgttcagatacagcctcatacacagccagatcaacaagtgcaaaaagagacgactgag
gaaatgaagcgtatactaggacagcttattggtctgaattctccaaattccatatctcga
gctgcaagaagtttgtatgatcagtttaacagtggcagaagcttggatctgtcagcactt
ggaacaacagttaatcaaaacacacggactatgaaataa

DBGET integrated database retrieval system