KEGG   Xenopus tropicalis (western clawed frog): 780139Help
Entry
780139            CDS       T01011                                 

Gene name
art1, art2, cd296, rt6
Definition
ADP-ribosyltransferase 1 (EC:2.4.2.31)
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     780139 (art1)
Cellular antigens [BR:xtr04090]
 Proteins
  780139 (art1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 317 aa AA seqDB search
MGPGHPGTNISWALALVSTLSFIPPSEGDRSRMSRRDVFLSKESVLDMAPSSYDDQYRGC
TEAMEAEIPKLFQYEYSLNKDFAEAWDSATFRWEERKGKMVVPPGFKDQYAIAIFSYTSN
GPLHKIFNDAVRQAGQSRDYYLRSFNFKVLHYYLTRALQMLDAVESPTCHKVFRGIKGVR
FKPEPRKPVRFGQFTSSSKDDQSALSFGEDTFFSIHTCYGVNIRNFSFFPSEEEVLIPPF
EKFKVTDFSTMSRKNIITLQSVEKSSVYNCEFVKERRCKASWCPFNSASHPGTGILQIIP
ICWLMLLWGPQPWIPLF
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggggcccgggcaccctggtaccaacatcagctgggcactcgctctggtatcaaccctg
tcattcatcccccccagtgagggggacaggagtcgaatgtccaggagagacgtgttccta
tcaaaggagtccgtgttggatatggccccctcttcctatgatgatcagtacagggggtgc
actgaggccatggaggccgagatccccaaactctttcaatatgaatattctctaaacaag
gacttcgctgaagcctgggattctgctacattcagatgggaagagagaaagggaaagatg
gtggttccccctgggtttaaggaccagtacgcaatagcgatatttagctacaccagcaat
gggcccctccacaaaatcttcaatgacgcggtgcgccaggccgggcagtccagagactac
tatctgagaagcttcaatttcaaggtcctacactactacctgaccagggcacttcagatg
ttggatgccgtggaatctccaacttgtcacaaagtctttagaggaataaagggggttcgg
ttcaaaccagagcccaggaagccggtgcgttttggccaattcacttcttcatcgaaggat
gaccagagcgccttgtcctttggagaggacaccttctttagcatccatacctgctatggg
gtcaacattaggaacttctcgttcttccccagcgaggaggaagtgcttatcccacccttc
gagaagttcaaagtgacggatttcagtacaatgagcagaaaaaacatcatcacccttcag
tctgtggaaaagtccagcgtgtacaactgtgagtttgtgaaagagagaagatgcaaagcc
tcgtggtgcccattcaattcagcctcgcaccccgggacgggaattctgcagataattccg
atttgttggctgatgctcctgtggggccctcagccttggattcccctattctga

DBGET integrated database retrieval system