KEGG   Xenopus tropicalis (western clawed frog): 780276Help
Entry
780276            CDS       T01011                                 

Gene name
setd8, pr-set7, set07, set8
Definition
SET domain containing (lysine methyltransferase) 8 (EC:2.1.1.43)
Orthology
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:xtr00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 336 aa AA seqDB search
MGRGKKMSKPGDGRSGDVPDTGRTGGTNENHPKINGEVAHLGQPKIYSFMSPTKSPSARP
PLQEENSVAHHESKCPGKPLTETRKKAEVEKKRISSGTELSVKPSEQRETECNSIGEFLD
PKQEQTDVRRNIALPPADKLNHQKMVKDKPLRRKAQRKKSPNRKLTDYYPVRRSCRKSKT
ELESEEKKRIDELIQTGKEEGMKMDMITGKGRGVIATRDFQRGEFVVEYHGDLIEITDAK
RREATYAQDSNTGCYMYYFQYLNKTYCIDATRETGRLGRLINHSKSGNCHTKLHNINNVP
HLILVASRDINVGEELLYDYGDRRKSSLEAHPWLKN
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgggaagagggaagaaaatgtccaaacccggcgacggaagaagcggggacgtcccagat
accggcaggaccggaggcaccaatgaaaatcatcccaaaataaacggggaagtggctcat
ttagggcagcccaaaatctactcctttatgagcccaactaaatctcccagtgcccgccct
cccttgcaagaagaaaactctgtagcgcaccatgagagcaagtgtccagggaaaccttta
acagagactcgcaaaaaagcagaggttgagaaaaagcgaatatcttcagggacagaactg
tcagtgaaacccagtgagcaaagagagactgaatgcaattctataggagagtttcttgat
cctaaacaagaacagactgatgtccgaagaaacatagcattgccacctgcagacaagctg
aaccatcagaagatggttaaagacaaacctctaagaaggaaggctcagaggaagaaatcc
ccaaacagaaaacttactgattattaccctgtgagaagaagctgcaggaagagtaaaaca
gagcttgagtcagaggagaagaagagaatagacgaacttattcagactggcaaagaagaa
gggatgaagatggacatgattactgggaaaggtcgaggtgtaattgcaactcgggacttc
cagcgaggagagtttgttgtagaataccatggagatctaatagagatcacggatgctaaa
aggcgagaggcaacttacgcacaggattcaaatactggctgctatatgtactattttcag
tacttgaacaaaacctactgcatcgatgctacaagagaaactggccgtttaggaaggctg
atcaaccacagcaaatctgggaactgtcacaccaaactgcacaacatcaacaatgtacct
caccttatactcgttgcatcgcgggatatcaacgttggagaggaattgctgtatgactat
ggggatagaagaaaatcttccttagaggcacatccttggcttaaaaactga

DBGET integrated database retrieval system