KEGG   Xenopus tropicalis (western clawed frog): 780300Help
Entry
780300            CDS       T01011                                 

Gene name
cdkn2d, ank2, ink4d, p19, p19-ink4d
Definition
(RefSeq) cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
  KO
K06623  cyclin-dependent kinase inhibitor 2D
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04068  FoxO signaling pathway
xtr04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    780300 (cdkn2d)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    780300 (cdkn2d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank Ank_3
Motif
Other DBs
NCBI-GeneID: 780300
NCBI-ProteinID: NP_001072839
Xenbase: XB-GENE-483786
UniProt: Q0P4P6
Position
3
AA seq 161 aa AA seqDB search
MLLQETSAGDRLTRAAARGDLLEVKRLLHEERIHPDCLNRFGKTALQVMMFGSTPVASEL
LKQGASPNIQDAYGTTPAHDAARCGFLDTLQVLVQHGAEINTPDASGSLPIHLALKAGHV
PVITYLALISDLQHRDREGHTPSQLAAILDPRLASIFELST
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgttgctacaagagaccagcgccggagaccgcctgacacgagcggctgccaggggagac
ctattagaagtgaagaggcttctccatgaagagaggatccaccctgactgcctaaaccgt
tttggcaaaactgctctgcaggtcatgatgtttggcagcacccctgttgcatcagagctt
ttgaaacaaggtgcctctcctaatattcaagatgcatacggcaccacccctgctcatgat
gcagcccgttgcggattcctggacaccttacaagttttggtccagcatggagcggagatc
aacacacctgatgcctctggctccctacctatacacctagcccttaaagcaggtcacgtc
cctgttattacctaccttgctcttatctccgaccttcagcatcgggatcgggaagggcac
acgccatcacagttggccgccatcttggatcctcgcctggcttccatatttgagctcagc
acatag

DBGET integrated database retrieval system