KEGG   Xenopus tropicalis (western clawed frog): 780300Help
Entry
780300            CDS       T01011                                 

Gene name
cdkn2d, ank2, ink4d, p19, p19-ink4d
Definition
cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Orthology
K06623  
cyclin-dependent kinase inhibitor 2D
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
FoxO signaling pathway
Cell cycle
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xtr04068]
Cellular Processes; Cell growth and death; Cell cycle [PATH:xtr04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 161 aa AA seqDB search
MLLQETSAGDRLTRAAARGDLLEVKRLLHEERIHPDCLNRFGKTALQVMMFGSTPVASEL
LKQGASPNIQDAYGTTPAHDAARCGFLDTLQVLVQHGAEINTPDASGSLPIHLALKAGHV
PVITYLALISDLQHRDREGHTPSQLAAILDPRLASIFELST
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgttgctacaagagaccagcgccggagaccgcctgacacgagcggctgccaggggagac
ctattagaagtgaagaggcttctccatgaagagaggatccaccctgactgcctaaaccgt
tttggcaaaactgctctgcaggtcatgatgtttggcagcacccctgttgcatcagagctt
ttgaaacaaggtgcctctcctaatattcaagatgcatacggcaccacccctgctcatgat
gcagcccgttgcggattcctggacaccttacaagttttggtccagcatggagcggagatc
aacacacctgatgcctctggctccctacctatacacctagcccttaaagcaggtcacgtc
cctgttattacctaccttgctcttatctccgaccttcagcatcgggatcgggaagggcac
acgccatcacagttggccgccatcttggatcctcgcctggcttccatatttgagctcagc
acatag

DBGET integrated database retrieval system