KEGG   Xenopus tropicalis (western clawed frog): 780353Help
Entry
780353            CDS       T01011                                 

Gene name
ube2d1, e2(17)kb1, sft, ubc4/5, ubch5, ubch5a
Definition
(RefSeq) ubiquitin conjugating enzyme E2D 1 (EC:6.3.2.19)
  KO
K06689  
ubiquitin-conjugating enzyme E2 D/E [EC:2.3.2.23]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    780353 (ube2d1)
   04120 Ubiquitin mediated proteolysis
    780353 (ube2d1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     780353 (ube2d1)
Ubiquitin system [BR:xtr04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   780353 (ube2d1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 147 aa AA seqDB search
MALKRIQKELNDLQRDPPAQCSAGPVGDDLFHWQATIMGPTDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLV
PDIAQIYKSDKEKYNRLAREWTQKYAM
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaagagaatacagaaggaactgaatgatttgcaacgtgaccctccggctcag
tgctctgctggcccagtaggagatgacttgttccactggcaagcaaccataatgggacct
actgacagcccatatcaagggggcgtctttttcctcacaattcacttcccaacagactat
ccattcaaaccaccaaaggttgcattcacaacaaaaatctatcacccaaacataaacagt
aatggaagtatttgcctcgacatcctaaggtcacagtggtccccagcgctgactgtgtca
aaagttttgttgtcaatatgctccttactttgtgatccaaatccagatgatccattagta
ccagatattgcacaaatctacaagtcagacaaggaaaaatacaacagactagcgagagaa
tggactcagaaatatgcaatgtaa

DBGET integrated database retrieval system