KEGG   Xenopus tropicalis (western clawed frog): 780390Help
Entry
780390            CDS       T01011                                 

Gene name
pik3cb, p110-beta, pi3k, pi3k92e, pi3kbeta, pik3c1
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00562  Inositol phosphate metabolism
xtr04012  ErbB signaling pathway
xtr04068  FoxO signaling pathway
xtr04070  Phosphatidylinositol signaling system
xtr04140  Autophagy - animal
xtr04150  mTOR signaling pathway
xtr04210  Apoptosis
xtr04218  Cellular senescence
xtr04370  VEGF signaling pathway
xtr04510  Focal adhesion
xtr04620  Toll-like receptor signaling pathway
xtr04625  C-type lectin receptor signaling pathway
xtr04810  Regulation of actin cytoskeleton
xtr04910  Insulin signaling pathway
xtr04914  Progesterone-mediated oocyte maturation
xtr04933  AGE-RAGE signaling pathway in diabetic complications
Module
xtr_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    780390 (pik3cb)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    780390 (pik3cb)
   04370 VEGF signaling pathway
    780390 (pik3cb)
   04068 FoxO signaling pathway
    780390 (pik3cb)
   04070 Phosphatidylinositol signaling system
    780390 (pik3cb)
   04150 mTOR signaling pathway
    780390 (pik3cb)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    780390 (pik3cb)
  Cell growth and death
   04210 Apoptosis
    780390 (pik3cb)
   04218 Cellular senescence
    780390 (pik3cb)
  Cellular community - eukaryotes
   04510 Focal adhesion
    780390 (pik3cb)
  Cell motility
   04810 Regulation of actin cytoskeleton
    780390 (pik3cb)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    780390 (pik3cb)
   04625 C-type lectin receptor signaling pathway
    780390 (pik3cb)
  Endocrine system
   04910 Insulin signaling pathway
    780390 (pik3cb)
   04914 Progesterone-mediated oocyte maturation
    780390 (pik3cb)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    780390 (pik3cb)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     780390 (pik3cb)
Membrane trafficking [BR:xtr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    780390 (pik3cb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 DUF4135 RWD
Motif
Other DBs
NCBI-GeneID: 780390
NCBI-ProteinID: NP_001072928
Xenbase: XB-GENE-482674
UniProt: Q0IHS8
Position
5
AA seq 1065 aa AA seqDB search
MPPIMDHMDIWTADTPLPPDICVDVLLPTGIYVQMDVPRDASISHIKQLLWKHAQSYPLF
HLLLEIDSYMFQCVNHNAVHEELEDETQRLCDVRPFLPVLKLVSRSCNPAEKLDSKIGVL
IGKGLQEFDALKDNEVMEFRSKMRSISEAKIQSLLGLTWVEWLKRTFPPELEPSIQDNIQ
GKLYGGNIVVAIHFENCQDVFSFQVSPNMVPVKVNELAIRKRLTIHGREAEEVDPEDFVL
QVNGRLEFVFGDHPLIQFQYIRNCVMNKALPHLTLVECCNIKKLFDQEMSEIEHAVRRKS
SMHPALPMPLPPKKRGASMKTLNMRDIVWNIVQPYKIILSKGSRLNTEDSVLVRAGLFHG
TELLCKPTMTPEVQGKNDHVWNETLEFEINVCDLPRMARLCFAIYAVLDKPRNKNKTKYQ
TIKKSGKMHFPVAWVNTMVFDYKGQLRSGDHVLHCWSSFPDELEEMLNPMGTVRTNPYTE
NTTTLHIKFHDYSKEPISYPPFDKILEKAAEIARNSDSLSTSGRGGKKLNIELKEIMERD
PLCQLSENEKDLIWTLRYDCRENFPGSLPKLLLSVKWNKLEDVAQLQALLQIWSKLPPRD
ALELLDFNYPDQYVREYAVNCLKPMSDEELSQYLLQLVQVLKYEPFLDCALSRFLLQRAL
DNRRIGQFLFWHLRSEVHNPAVSVQFGLLLEAYCRGSVAHMKVLSRQVEALNKLRTLNGL
IKLNAVKLSKVKNKDNMHTCLRENAYKEALMHIQSPLNPSITLSELVVEKCKYMDSKMKP
LWIVYNNRGFGSDSLGIIFKNGDDLRQDMLALQLLRLMDMLWKEAGLDLRIVPYGCLATG
DRCGFIEVVSAAETIADIQLDSSNLAAAAAFNKDALLNWIKECHSGDDLERAIEEFTLSC
AGYCVATYVLGIGDRHNDNIMVRKTGQLFHIDFGHILGNFKSKFKIKRERGPFILTYDFI
HVIQQGKPGNTEKFGRFRQCCEDAYLILRRNGNLIITLFALMLTAGLPELSSVKDIQYVK
DSLALGKKEEDALKQFRQKFDEALKESWTTKVNWMAHTMRKDYKA
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atgccccctataatggaccacatggacatctggacagcagatacaccgcttcctccagat
atctgtgtggacgtcttgcttcccactggtatatatgtgcagatggacgtcccaagggat
gcatccatatctcatattaaacagctcctgtggaagcatgcacagagctaccctctgttt
cacctccttctggagattgactcctatatgttccagtgcgttaatcataatgctgttcac
gaagagctagaggatgagactcaacgtttgtgtgatgttcgccccttcctgcctgtcctg
aaattggtatcccgaagctgcaatcccgcagagaagttagattccaagataggggttctg
ataggaaaaggtcttcaggaatttgatgccctaaaagacaacgaggtcatggaattccgc
agcaagatgagaagtatcagtgaggcgaagatccaatccctgcttggcctaacatgggta
gagtggctaaagcgtacattccccccagaactagaaccatccatacaggataacatccaa
ggcaagctctatggtggcaacattgtagtggccattcattttgagaactgccaggatgta
ttcagttttcaagtgtctccgaacatggtccctgtgaaagtaaatgagcttgctattcga
aagcgcctgactatccatggcagagaagcggaagaggtagatcctgaggattttgtgctg
caggtcaacggaaggctggaatttgttttcggggatcaccctttaattcagtttcagtac
atcagaaactgtgtaatgaacaaggctttgccacatctaacactggttgagtgttgcaac
atcaaaaaactgtttgaccaagagatgagtgagattgaacatgctgtgaggagaaagtca
tccatgcacccagcgcttccaatgcccttgcctccaaagaaacggggtgcatcaatgaag
actctgaatatgcgggatattgtgtggaatattgttcagccatacaagatcatactgtcc
aaagggagtagactgaacacagaggacagtgttttggtccgggctggcctttttcatggc
accgaactattgtgtaaacccacaatgactccggaagtgcaaggaaagaatgatcatgtt
tggaacgagacactggaatttgaaatcaatgtctgtgaccttccacgaatggcacgtctc
tgttttgctatatacgctgttctggacaagcctaggaacaagaacaaaaccaaatatcag
acaatcaagaagtctggcaaaatgcacttccctgtagcctgggtgaacaccatggtgttt
gactacaaagggcagctgagatctggggaccatgtattgcactgctggtcgtcattccct
gatgaacttgaagaaatgctaaatcccatgggaacagttcgaaccaatccttacactgag
aataccacaactctacacataaagtttcacgactactccaaagaacccatttcttatcca
ccatttgataagatacttgaaaaagctgctgaaattgcacggaacagtgacagcctgtct
acgtcgggtcgaggtgggaaaaagcttaatattgagctcaaggagatcatggaacgggac
cctttgtgccagttatctgagaatgagaaggatctgatctggaccttgcggtacgactgt
agagagaactttcctggctctctgcccaagcttctcttgtctgtcaagtggaacaagctg
gaggatgtggcacagcttcaagccctactccaaatctggtccaaacttcccccaagggat
gccctggaattgcttgactttaactatcctgaccagtatgtgagagaatatgcagtcaac
tgtcttaaaccaatgagtgatgaggagctctcccagtaccttctgcagcttgtgcaggtt
ctgaagtatgagccgtttctggactgtgccctgtcacgcttcctcctacagagagccctg
gataaccgcaggataggacagttcctcttctggcacctgaggtctgaggtccataaccct
gctgtctctgtgcaatttggcctgctgctggaagcatactgccgagggagcgtggcccac
atgaaagtgctgtctagacaggtggaggctctgaataaactgcgcacgttaaatggacta
atcaaactgaatgctgtgaagctgagcaaggtcaaaaacaaagacaatatgcatacatgc
ctgagggagaacgcctacaaggaggcactgatgcacattcagtcgcccctcaaccccagc
atcaccctttctgaacttgttgtagagaagtgcaagtacatggattctaagatgaagccc
ctctggattgtgtacaacaaccgtggatttggcagcgactctcttggaatcatctttaaa
aatggggatgacctacgtcaggacatgctagcacttcagctgctgcggcttatggacatg
ttgtggaaggaggctgggttggacctgaggatagtgccttatggctgcctagcaactgga
gatcgctgcggttttatagaggtggtgtccgctgcagagactattgcagacatccagctg
gacagcagcaaccttgcggctgcagccgctttcaacaaagatgctctgttaaattggatc
aaggaatgtcattctggtgatgacctagagcgagctattgaggaattcaccttgtcctgt
gctggctactgtgtagctacttacgttcttggaattggtgaccgccacaatgacaacatc
atggttaggaagaccgggcagctttttcacattgattttggacacattctggggaacttc
aagtccaagtttaaaattaagagggagcgtgggccctttattcttacgtacgacttcatt
cacgtgatccaacagggaaaaccagggaacacagagaaatttggcaggtttcggcagtgc
tgcgaggatgcctacttgatcctacgcagaaatgggaacctcatcattactctgtttgca
ctaatgctgacagctggactccctgagctgagttctgttaaagatatccagtatgtcaag
gactcccttgccctgggcaagaaagaggaggacgcacttaagcaattccgccagaagttt
gatgaggccctaaaagaaagctggacaaccaaagttaactggatggcccacacaatgcgc
aaggattacaaggcttag

DBGET integrated database retrieval system