KEGG   Xenopus tropicalis (western clawed frog): 780394Help
Entry
780394            CDS       T01011                                 

Gene name
plcb1, pi-plc, plc-154, plc-i, plc154
Definition
phospholipase C, beta 1 (phosphoinositide-specific) (EC:3.1.4.11)
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
GnRH signaling pathway
Melanogenesis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    780394 (plcb1)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    780394 (plcb1)
   04020 Calcium signaling pathway
    780394 (plcb1)
   04070 Phosphatidylinositol signaling system
    780394 (plcb1)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    780394 (plcb1)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    780394 (plcb1)
   04916 Melanogenesis
    780394 (plcb1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    780394 (plcb1)
   04270 Vascular smooth muscle contraction
    780394 (plcb1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     780394 (plcb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 426 aa AA seqDB search
MAGAQPGVHALQLKRVCVSDNMKKGTKCMKWDDDSTLVYPIILKMDPNGFFLYWTDQNKE
AELLDISLVKDARCGRHARTPKDPKLREQLEVGNFGGRLEYRMFTIVYGPDLVNISYLNL
VAFQEEIAKEWTDEVFSLATNLLAQNMSRDAFLEKAYTKLKLQANPEGRIPVKNINRLFS
ADRKRVETALEACNLPSGRSDSIPQDDFTPEVYKVFLNNICPRPEIDNIFSEFGSKSKAH
LTVDELTEFINSKQRDPRLNEILYPPLKQEQVQQLIEKYEPNSPLATGGQISVEGFMNYL
SGEENGVVPPEKLDLNEDMSQPVSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLAGCRC
VELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPYPVVLSFENHVDSPK
QQASEK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcaggggcacaaccaggggtccatgctctgcagctcaaacgggtctgcgtgtctgac
aacatgaagaaaggaaccaagtgcatgaaatgggatgatgactccactctcgtctatcca
atcattcttaaaatggatcctaatggatttttcctttactggaccgatcagaataaggag
gccgagcttttggatatcagtctagtgaaagatgccagatgtggaagacatgcccgtact
ccaaaggacccgaaactacgtgaacagttagaggtggggaactttggaggccggctggag
taccgcatgtttacaattgtctatggaccagatttggttaacatctcatatttgaatttg
gtggcgtttcaggaagaaattgccaaggagtggacagatgaggtattcagtctggcaacc
aatttgctggcgcagaacatgtccagagatgcgtttcttgaaaaagcttataccaagctg
aaactgcaagcgaatcctgaaggacgaatccctgttaaaaacataaaccgcctcttctct
gcggatagaaaaagagtggaaactgcactggaggcttgtaatcttccatctggcagaagc
gactcgattcctcaagatgactttactccagaggtttacaaagtcttcttgaacaatata
tgcccgcggcctgagattgacaacattttttctgagttcggcagtaagagtaaagcacac
ctaaccgttgatgagctgacagaatttattaactcgaagcagcgagatccgcgattaaat
gaaattctctatccaccgctaaagcaggagcaagtccaacagctgattgaaaaatatgag
ccgaacagccctttggcaacaggaggccagatatctgtggagggatttatgaactatctg
agtggagaggagaatggagttgtgccacctgagaaactggatttaaatgaagacatgtct
cagcccgtatctcattatttcattaattcttcacataatacctacctcactgctgggcag
ctggctggtaactcttcagtggagatgtatcgtcaagtgctcttggcaggctgtcgatgt
gtggaactggattgctggaaggggcgaactgcagaggaagagccggttattacccatgga
ttcaccatgacaacagaaatatcatttaaggaagttatagaagctatcgctgaatgtgca
tttaagacctcaccgtacccggtcgttctctctttcgaaaatcacgttgattcgccaaaa
caacaggccagtgagaaataa

DBGET integrated database retrieval system