KEGG   Yersinia enterocolitica FORC_002: FORC2_1707Help
Entry
FORC2_1707        CDS       T03890                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
yef  Yersinia enterocolitica FORC_002
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yef00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FORC2_1707
   00500 Starch and sucrose metabolism
    FORC2_1707
Enzymes [BR:yef01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     FORC2_1707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1952251..1953720
Genome map
AA seq 489 aa AA seqDB search
MNPLIERANDALQTLASQVGQNFYPHYHLAPPAGWMNDPNGLIFFNGQYHAFYQHHPYDE
NWGPMHWGHATSHDMLSWQHQSIALAPGDLWDKDGCFSGCAVDDNGVLSLIYTGHVWLNG
EGDDSAIREVQCLATSQDGIHFDKQGVVLTPPEGIMHFRDPKVWFEDDCWWMVVGARDER
DHGQVLLYRGNSLQQWQFMQVLARADDSMGYMWECPDFFPLGNERILMFSPQGLAAKGYL
NRNLFQSGVLRGKWQPGADFKPSQPFTELDLGHDFYAPQSLLTADGRRVIIGWMDMWQSP
MPTKADNWSGCLTLPRELSIDCDGNLLIKPVREVEALRQAGEFITSMTLAQEKQLLHENC
QSLELQLTWDTTASHAERYGVQLADAQGTGGKVSVYVDSQANRLVLDRYYPQYGLTGYRS
VVLPEQGVLSLRIFIDSSSLEVFINDGQACMSSRIYPTEHERCLSLYAENGQAQLLHGEY
WQLVAKSLR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaatccattaattgaacgggccaatgatgcactgcaaactttagcttctcaggttggc
caaaatttctatccacattatcatttggctccgccggcagggtggatgaatgaccccaac
gggttgatcttttttaacggacagtatcacgcgttttatcagcatcacccttatgatgaa
aattgggggccgatgcattggggccatgcgaccagccacgatatgttgagttggcaacat
caatccattgccttagctccaggtgatttatgggataaagacggttgtttttctggttgt
gcggtagacgataatggcgtgttaagcctgatttataccggacatgtttggcttaacggt
gagggtgatgacagcgctattcgcgaggtgcagtgcctggcaaccagtcaggatggcata
cattttgacaaacaaggtgtggtactgaccccgcccgagggaatcatgcatttccgcgat
ccgaaagtgtggtttgaagatgattgttggtggatggtagtcggtgctcgagatgagcga
gatcatgggcaagtcttgctatatcgcggcaattcattgcagcaatggcaatttatgcaa
gttttagcgcgcgcagacgacagcatgggatatatgtgggaatgtccagatttcttccca
ttagggaatgaacgtattctgatgttttcaccgcaggggctggcagcaaaaggttacctc
aatcgcaatttgttccaaagtggtgtcttacgcggcaaatggcagccaggagccgatttt
aagccttcgcagccttttaccgaactggatctgggccatgatttctatgcacctcaatcc
ctacttactgctgatgggcggcgagtcattattggttggatggatatgtggcaatcgcct
atgccgaccaaggccgataattggagtggctgcttaaccttgccacgagaattaagtatt
gattgtgatggtaatttattaataaaaccggtgcgggaggttgaagcactaaggcaagcc
ggtgaattcatcacatcaatgacactggcccaagagaaacaacttttacatgaaaattgc
cagagtctggaactgcaattgacatgggataccacagccagtcatgcagaaagatatggt
gtgcagttagctgatgcccaaggaacgggtggtaaagtttcggtttatgtcgatagtcag
gctaatcgactagttttggataggtattacccacaatatggactgacggggtatcgcagt
gtggtattaccagaacagggggtattatcattacgtatatttattgatagttcgtcgttg
gaggtatttatcaatgacgggcaagcttgtatgagcagtcgtatctacccgaccgagcat
gaacgctgtttatccctgtatgcggagaatggtcaggcccagctactacacggcgaatac
tggcagttagtggctaaatcattacgttga

DBGET integrated database retrieval system