KEGG   Yersinia enterocolitica LC20: LC20_03213Help
Entry
LC20_03213        CDS       T03179                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
yel  Yersinia enterocolitica LC20
Pathway
yel00052  Galactose metabolism
yel00500  Starch and sucrose metabolism
yel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yel00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LC20_03213
   00500 Starch and sucrose metabolism
    LC20_03213
Enzymes [BR:yel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     LC20_03213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975
Motif
Other DBs
NCBI-ProteinID: AHM74466
UniProt: A0A2K7ZIM3
Position
complement(2760558..2762018)
Genome map
AA seq 486 aa AA seqDB search
MNSLIERANAAQQTLASQVGQNFYPHFHLAPPAGWMNDPNGLIFFKGHYHAFYQHHPYDE
NWGPMHWGHATSPDMLCWQHQPIALAPGDPWDKDGCFSGCAVDDNGVLSLIYTGHVWLKD
EGDDSAIREVQCLATSQDGIHFDKQGVVLTPPEGIMHFRDPKVWFEDDYWWMVVGARDSR
DHGQVLLYRGISLHEWQFMQVLARADDGMGYMWECPDFFPLGDERILMFSPQGLAAQGYR
HRNLFQSGVLRGQWQPGGDFTPSQPFTELDHGHDFYAPQSLLTADGRRVIIGWMDMWQSP
MPTKADNWCGCLTLPRELSLDTQGQLLMQPIREVEALRQSSQSAIPATRLQDKQLLLENC
RSMEWQLLWDTATSQAEKYGLQLGDSHGTGGRVSIYVDNQANRLILERYYPQHGLTGYRS
VALAESGLLSLRVFIDSSSIEVFINDGQACMSSRIYPAPHERYLSLFAENGPAELLSGKY
WHLVTR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaattcattaattgagcgggcaaatgccgcacaacaaactttagcttctcaggtcggc
cagaatttctatccccatttccatttggctccgccagcggggtggatgaatgatcctaat
gggctgatttttttcaaggggcactatcacgcgttttatcagcatcacccctatgatgaa
aattgggggccgatgcactggggccatgcgaccagccccgatatgctgtgttggcagcat
cagccgattgcattagcaccgggagacccgtgggataaagacggctgtttttccggctgt
gcggttgacgacaatggcgtgttaagtctgatttataccggccatgtttggcttaaagat
gagggcgatgacagtgccattcgcgaagttcagtgtctggcgaccagccaggatggcata
cattttgacaagcagggtgttgtgctgactcctcctgagggcatcatgcattttcgtgat
cctaaagtgtggtttgaggatgattattggtggatggttgttggtgcccgagattcgcgc
gatcatgggcaagttttgctatatcgcggaatttcactgcatgaatggcaatttatgcaa
gttttggcgcgcgccgatgatggcatgggatatatgtgggaatgcccagatttctttcca
ttgggtgatgagcgaatcctgatgttttcaccacagggcttggctgcgcaaggttaccgc
catcggaacttgttccaaagtggggtgttgcgcggacaatggcagccaggtggcgatttt
accccatctcaaccttttaccgagttggatcacggccatgatttctatgcaccgcaatcc
ctactgactgctgatggtcgtcgagtcatcattgggtggatggatatgtggcaatctccc
atgccgactaaagccgataattggtgcggttgcctgacgttaccacgggaattaagtctt
gatactcaaggccagctattgatgcagccaatacgagaagttgaagcattaaggcagtcc
agtcagtcagctattcccgccacgcggttgcaagataaacaactgttgctcgaaaactgc
cgcagtatggaatggcagttgctgtgggataccgccaccagccaggcggaaaaatatggt
ttgcagctgggtgatagccatgggacgggaggtcgagtatctatttatgtggataatcag
gctaatcgactcattctcgagcgatattatccgcagcatggtttgacgggatatcgcagt
gtggctctggccgagtcaggattattatcattgcgcgtctttattgatagctcatcgatc
gaggtatttatcaatgatgggcaggcctgtatgagtagccgtatctatcctgcaccgcat
gagcgctatttatccttgtttgcagagaatggcccggcggaactgctgagcggtaaatat
tggcatttagtcactcgctaa

DBGET integrated database retrieval system