KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE0047Help
Entry
YE0047            CDS       T00469                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
yen00230  Purine metabolism
yen01100  Metabolic pathways
Module
yen_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    YE0047 (gmk)
Enzymes [BR:yen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     YE0047 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 RsgA_GTPase AAA_33 ABC_tran AAA_22 MMR_HSR1 Viral_helicase1 AAA_29 cobW
Motif
Other DBs
NCBI-GeneID: 4715296
NCBI-ProteinID: YP_001004443
UniProt: A1JHV8
Position
complement(58071..58694)
Genome map
AA seq 207 aa AA seqDB search
MVQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAKRPGENHGEHYFFVSKE
EFCQMIDDDAFLEHAKVFENYYGTSRLAIEQVLATGVDVFLDIDWQGAQQIRAKMPTARS
IFILPPSKEELDRRLRGRGQDSEEVIAKRMAQAVAEMTHYAEYDYLIVNDDFNLALSDLK
TIIRAERLRLGRQKQRHDALITKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaggtacgctatacatagtttccgcacccagtggggcagggaaatcaagcctg
attcaggctttgttaaaaacacaacctttgtacgacacgcaggtttctatttctcatacc
acgcgtgctaaacgtcctggggagaatcacggcgagcattacttctttgtttccaaagaa
gagttttgccagatgattgatgacgatgcttttcttgagcatgccaaagtatttgagaat
tactatggcacctcacgtctggcaattgagcaggttctcgcaaccggtgttgatgtgttt
ttagatatcgactggcaaggcgcgcagcaaattcgcgcaaaaatgccgaccgcgcgcagt
atctttattttgcccccatccaaagaagaattggatcgccgtttacgcggccgtgggcag
gatagtgaagaggttattgcaaagcgaatggcgcaagctgtcgcggaaatgacccattat
gcagaatatgattatttaatcgtgaatgatgacttcaatctggcattgtctgatctgaaa
accattattcgcgctgagcgactgcgcttaggccgccagaaacagcggcatgacgcttta
atcaccaaattattggcagactga

DBGET integrated database retrieval system