KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE0093Help
Entry
YE0093            CDS       T00469                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YE0093 (tpiA)
   01230 Biosynthesis of amino acids
    YE0093 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YE0093 (tpiA)
   00051 Fructose and mannose metabolism
    YE0093 (tpiA)
   00562 Inositol phosphate metabolism
    YE0093 (tpiA)
Enzymes [BR:yen01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     YE0093 (tpiA)
Exosome [BR:yen04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YE0093 (tpiA)
  Exosomal proteins of bladder cancer cells
   YE0093 (tpiA)
  Exosomal proteins of melanoma cells
   YE0093 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(102318..103085)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIANLRKELSTVEGCGVAIAPPAIYLNQAKHELSGSRIA
LGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDEFIAKKFGVLKEVG
LTPVLCIGETEAENEAGQTEAVCAKQLDAVLNTLGAKAFEGAVIAYEPIWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAIAAQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAAAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatccattagttatgggtaactggaaactgaacggtagcactcacatggttaac
gagcttatcgctaacctgcgtaaagaactgagcactgttgaaggttgtggcgtggctatt
gccccaccagctatctatctgaatcaagctaagcatgaattatcgggcagccgtatcgcg
ctgggcgcacagaacgttgatgtgaatctgtctggtgcatttaccggtgaaacctctgct
gaaatgctgaaagatatcggtgctcaatacatcatcatcggtcactctgaacgccgcact
tatcacaaagaaagtgatgaatttatcgcgaagaaattcggcgtactgaaagaagtcggc
ctgacgccggtattgtgcatcggtgaaaccgaagcagaaaacgaagccggccaaactgaa
gctgtttgcgctaagcaattagacgcagtgctgaacaccttgggtgctaaagcattcgaa
ggcgcggttatcgcttatgaaccaatctgggctatcggtactggcaaatcagcaactcct
gcgcaggctcaagcggttcacaaatttatccgtgaccatatagccaaacaagacgccgcc
attgccgcacaagttatcatccagtacggcggttctgttaacgataagaacgcagcagaa
ctgttcacccagcctgatatcgatggcgcgctggtgggtggtgcatcactgaaagcggat
gctttcgcggttatcgtgaaagcagccgcagcagctaaaaaagcctaa

DBGET integrated database retrieval system