KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE0207Help
Entry
YE0207            CDS       T00469                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:yen00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
243778..244833
Genome map
AA seq 351 aa AA seqDB search
MPLDNHMNNWLTREEQFAAFVNGPLLDFWQQRDEDEFMGVDNIPIRYVRFCSPQHTRVVV
VVPGRIESYVKYPEVAYDLFQQGYDVIVLDHRGQGRSGRILDDRNRGHVIKFDDYIEDFA
QLVQREITGSHYQQRFALAHSMGGAILTRYLAREPTVFNAVALCAPMFGIHLPMPGWLAH
RIVDWTEKHQKLRDYYAIGTGQWRPLPYVVNMLTHSRERYRRYLRQYADSPEIRVGGPTY
HWVRESLLVGEQIIAQADKITTPVLLLQASEDRVVHNPAHNAFTQAMTLAGHPCEGEQPK
LIKGARHEILFERDTLRAEALSAILRFFAQHHSSLQHKKPVGPQDSDTTRG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgccgttagataatcatatgaataactggttgacccgcgaagagcagtttgctgctttt
gttaacggcccattgttagatttctggcagcagcgggatgaagatgagtttatgggggtc
gataatatccccattcgctatgttcgtttttgttcaccgcaacatacccgcgtggtggtg
gtagtgcctggccgcattgaaagttacgttaaatatcccgaagtggcttatgatctattc
cagcaaggctatgatgttattgtgttggatcatcgtgggcagggccgatccgggcgaata
cttgatgatcgtaaccgcgggcatgtgatcaaatttgatgattacattgaagattttgcg
cagctggtgcagcgtgagataaccggaagccattatcagcagcgttttgcattggcccac
tctatggggggggcgatactgacccgttatctggcgcgagaaccgacagtgtttaatgct
gtagcgctctgcgcacccatgtttggcatccatttgccgatgccgggctggctggctcat
cggattgtcgattggactgagaaacatcaaaagctgcgggattactatgcaataggcacc
gggcagtggcggccattgccctatgtggtcaatatgctgactcacagccgcgagcgctat
cgccgctacttgcgccaatatgctgacagcccagaaatccgcgtcggcgggccaacctat
cattgggttcgtgaaagcctgctggtgggggagcaaattattgctcaagcagacaaaatt
accacaccggttctgttactacaggccagtgaggatcgggtagtacataacccggcccat
aatgcatttactcaggcaatgactctggcggggcacccttgcgaaggggagcagccgaag
ttaattaaaggcgcacgccatgagatcctgttcgaacgggacaccctgcgtgccgaggcg
ctaagcgccatattgcgcttttttgcgcaacatcactcttctttacaacataaaaaacca
gtcggccctcaagactccgacaccaccagaggttag

DBGET integrated database retrieval system