KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE0263Help
Entry
YE0263            CDS       T00469                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YE0263 (hemB)
Enzymes [BR:yen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     YE0263 (hemB)
Exosome [BR:yen04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YE0263 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
301770..302792
Genome map
AA seq 340 aa AA seqDB search
MSYAFPGTFPGRRMRRVRRHDFSRRLVAENQLTVNDLIYPVFVMEGNNHQQAVSSMPGVS
RMTIDLLVKEAEAIAKLGVPVISLFPVIESGMKSLHAEEAYNPNGLVQRTVRALKDAVPE
LGILTDVALDPYTTHGQDGVIDADGYVINDITKEILVRQALSHADAGAEIVAPSDMMDGR
IGAIRDQLELQGLVNTQIMAYSAKYASCYYGPFRDAIGSSSNLKGGNKKTYQMDPANSDE
ALQEIAQDLQEGADMVMVKPGMPYLDVVRRVKDTFGVPIFAYQVSGEYAMHMAAIQNGWL
QEKPTVMESLLCFKRAGADGVLTYFAKQVAQWLHDDQMQR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagctatgcatttccgggcaccttccctggtcgccgtatgcgccgtgtgcgccgtcat
gatttcagtcgtcgactggtcgctgaaaatcagctgacagttaatgatttgatctatccg
gtgtttgttatggaaggaaacaaccatcagcaagccgtttcgtctatgccgggtgtctcg
cgtatgacgattgatttgttggtgaaagaagctgaggctattgccaagcttggcgtcccg
gtcatatcgttattcccggtcattgaatcaggtatgaagtcactacacgcggaagaagct
tataacccgaatggcctggtacaacgtactgtacgtgcattaaaagacgctgtaccagag
ttaggtattcttacggatgttgccctcgacccatacacaacccatgggcaagacggtgtg
attgatgctgatggttatgtcattaacgatatcaccaaagaaattttagtgcgtcaggcc
ttatcacatgcagacgctggcgcagagattgttgccccgagcgatatgatggatggccgc
attggtgctattcgcgatcagttagaacttcaagggctggtaaatacacaaatcatggct
tattcagccaagtatgcctcttgttattatggcccattccgcgatgcaattggctccagt
agcaatttgaaaggtggcaataaaaaaacctatcaaatggacccggccaatagcgatgaa
gcgttgcaagaaatcgctcaggacttgcaggaaggggcggatatggtgatggttaaaccg
ggtatgccatatttggatgtggtgcgccgggtgaaagatacctttggggttccgatcttt
gcctatcaggtttctggtgaatatgcgatgcatatggctgcaatacaaaatggctggctg
caagagaaaccgacggtaatggagtcactattgtgctttaaacgcgcgggtgcggatggg
gtattaacctattttgctaagcaagtcgcacaatggctgcatgacgatcagatgcagcgt
taa

DBGET integrated database retrieval system