KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE0400Help
Entry
YE0400            CDS       T00469                                 

Gene name
amtA
Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:yen00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
466745..467488
Genome map
AA seq 247 aa AA seqDB search
MMLEQICQLAREAGVAIMAVYQGEKPLDVAHKKDDSPVTAADLAAHQIIKAGLAALTPDI
PLLSEEDPPTWAVRQHWQRYWLVDPLDGTKEFLSRNGEFTVNIALIDQGVPVLGVVYAPA
SEVMYSAENGQAWKEECGRRMQIEVRDAIPPLVVVSRSHSDAELEDYLAQLGEHQTVAVG
SSLKFCLVAEGKAQLYPRFGPTNVWDTAAGHAVAIAAGAQVHDWQGKPLSYIPRESFLNP
GFRVSLF
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatgttagagcaaatttgccagttggcccgcgaggcaggcgtggcgattatggcggtc
tatcagggggagaagccccttgatgtggcccataaaaaagatgattcgcccgttacggcg
gcggatcttgctgcccatcaaattatcaaagccgggttggcggcattgactcctgacatt
cctctgttatctgaagaggatccaccgacttgggcagtgcgccagcactggcagcgctat
tggttggttgacccactggatggcaccaaagaatttttgagtcgcaatggcgaattcacc
gtcaatatcgctctgattgaccaaggggtaccagtgctgggggtagtttatgctccggcg
agcgaagtgatgtatagcgcggaaaacggccaagcatggaaagaagagtgtggtcggcgt
atgcagattgaggtgcgtgatgccattccgccgctggtggttgtcagccgctctcacagt
gatgctgagttggaagattatttggcgcaattgggcgaacatcagacggtagcggttggt
tcatcactcaagttttgtctggtagccgaaggaaaagcacagctgtatccgcgctttggg
ccaaccaatgtgtgggatactgcggccgggcatgcggtggcgatagcggccggggcacaa
gttcacgattggcagggtaaaccactttcttatatcccacgtgaatctttcctgaacccc
ggctttagagtgtctttgttctag

DBGET integrated database retrieval system