KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE0429Help
Entry
YE0429            CDS       T00469                                 

Gene name
folP
Definition
(RefSeq) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
yen00790  Folate biosynthesis
yen01100  Metabolic pathways
Module
yen_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YE0429 (folP)
Enzymes [BR:yen01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     YE0429 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind KdpA
Motif
Other DBs
NCBI-GeneID: 4715802
NCBI-ProteinID: YP_001004799
UniProt: A1JIW4
Position
497847..498680
Genome map
AA seq 277 aa AA seqDB search
MHLTARDRVLDLTRPQVMGILNVTPDSFSDGGHHNNLDKALQHAELMLSAGATLIDIGGE
STRPGAAHVSEQEELDRVVPVVEALAKRFDVWLSVDTSKAAVITESARAGAHLINDIRSL
QEPDALEAAAKTGLPVCLMHMQGQPQSMQQSPHYDDLMADVNQFFKHHIDRCIAAGIAKS
KLLLDPGFGFGKNLAHNYQLLARLAELHHFELPLLVGMSRKSMVGQLLNVPPQQRVIGSV
ACAVIAAMQGAQIVRVHDVKETVEAMRVVEATLSAKG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcatttaacggccagagatcgggttttggatctcactcgcccacaagttatgggtatt
ttgaatgttacacctgactcattttcagatggtgggcatcacaataatcttgataaagca
ctacaacatgccgaactgatgttgtccgcaggtgctacgctgattgatattggtggtgaa
tccacccgtccgggggcggcacacgtcagtgaacaagaagagcttgatcgggtcgtgcct
gtggtagaagcgctggcaaaacgttttgatgtttggttatctgtcgatacatctaaagcg
gcggtaatcaccgagtcagctcgtgctggcgcccatctaatcaatgatattcgttcgttg
caagaacccgatgcgcttgaagcggcggctaaaactgggttgccggtgtgcctgatgcat
atgcaagggcagccacagagtatgcagcagtcccctcattacgatgatctgatggccgat
gtaaatcagttttttaagcaccatattgaccgctgtattgcggctggtatcgcaaaaagt
aaattgttactcgacccaggcttcggtttcggtaaaaatctagcgcataattatcagcta
ctggctcgtctggccgaacttcaccattttgagttgccattattggtagggatgtcacgg
aaatcaatggtcggtcagctactgaatgtcccgccacaacaaagggttatcggtagtgtg
gcttgtgctgtgattgccgccatgcaaggtgcacaaattgtcagggtgcacgatgtcaaa
gaaactgtcgaggcgatgcgagtcgtcgaggcaacactttcagcgaagggatga

DBGET integrated database retrieval system