KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE0499Help
Entry
YE0499            CDS       T00469                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    YE0499 (holC)
   00240 Pyrimidine metabolism
    YE0499 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    YE0499 (holC)
   03430 Mismatch repair
    YE0499 (holC)
   03440 Homologous recombination
    YE0499 (holC)
Enzymes [BR:yen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     YE0499 (holC)
DNA replication proteins [BR:yen03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     YE0499 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(574532..574981)
Genome map
AA seq 149 aa AA seqDB search
MKNATFYLLEHDTPAGELRAHEALACEIAAERWRAGKRVLIACESQEQAQRLDEALWQRA
PEQFVPHNLAGEGPKYGAPVELAWPERRGNSPRDLLISLLPEFAGFATAFHEVVDFVPYE
ENLKQLARDRYKSYRSVGFHLTTATPPTN
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgccacgttttatttgctcgaacacgacacgcccgctggtgagctgcgcgct
catgaggcgttggcctgcgaaattgcggccgagcgttggcgggcaggcaaacgggtactg
atcgcctgtgaaagtcaggaacaggcccagcggctggatgaagcgctatggcaacgggca
cctgagcaatttgttccccataatttggcgggtgaagggccaaagtatggcgcaccagtc
gaactggcttggccggaacgacgtggaaattccccccgcgacctgcttatcagcctgcta
ccagagttcgcaggttttgccaccgctttccatgaagtggtagacttcgttccttacgaa
gaaaatttgaaacagttggcgcgcgaccgatataagtcttatcgcagcgtcggcttccac
ttgaccacggcaacgccgccaactaattga

DBGET integrated database retrieval system