KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE0549Help
Entry
YE0549            CDS       T00469                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YE0549
   00500 Starch and sucrose metabolism
    YE0549
Enzymes [BR:yen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     YE0549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
627938..629023
Genome map
AA seq 361 aa AA seqDB search
MPINLLGKTLWLGLISFAVLGTVNAAQYNAVVSTTPQGDEFSSINAALKSAPKDDTPFII
FLKNGVYTERLEVARSHVTLKGENRDGTVIGANTAAGMLNPQGEKWGTSGSSTVLVNAPN
FTAENLTIRNDFDFPANKKKADTDPTKLKDTQAVALLLAENSDKARFKAVKLEGYQDTLY
SKTGSRSYFSDCEISGHVDFIFGSGITVFDNCNIVARDRSDIEPPYGYITAPSTLTTSPY
GLIFINSRLTKEPGVPANSFALGRPWHPTTTFADGRYADPAAIGQSVFINTTMDDHIYGW
DKMSGKDKQGEKIWFYPQDSRFFEANSQGPGAAINEGRRQLSAEQLKAFTLPMIFPDWAV
H
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaatttattgggtaaaacgctatggttaggattaatatcatttgctgtattg
gggacggtgaatgcagcgcagtataatgcagttgtttctaccactcctcagggagacgaa
ttttcctcgattaatgctgcattgaaatcagctccgaaggatgacactccttttattatt
ttcctgaaaaatggagtttatactgaaaggctcgaggtggcccgtagtcatgtcaccctc
aaaggagagaaccgcgatggcacggtgatcggtgccaatactgcggcggggatgctcaat
ccacaaggcgaaaaatggggaacttccggcagtagtactgtgctggttaatgctccgaac
tttacagccgaaaatctgactattcgtaatgattttgattttccagccaataaaaagaaa
gcggatactgacccaacaaaactaaaagatactcaagcggtggcactgttattagccgaa
aatagtgataaagcgcgtttcaaggcagtgaaacttgaaggttaccaggatacgctttat
agcaaaaccggcagccggagttatttctccgactgtgaaattagtggtcatgttgatttt
atttttggctcaggaatcacggtatttgataattgtaatatcgtggcgcgtgatcgaagt
gatattgagccgccttatggctatatcacggccccgagtacattaacgacctcgccttat
ggtttgatatttattaacagccgattgaccaaagagccaggtgttcccgctaatagtttt
gctttagggcgtccatggcacccgacaaccacttttgcggatggccgttatgccgatccg
gcagcaattggtcagtcggtatttatcaatacgacgatggatgatcatatttacggttgg
gataaaatgtctggcaaagataaacaaggcgagaaaatttggttctatccgcaagattca
cgtttctttgaggcgaatagtcaggggccgggagcagcaattaacgagggacgccgccag
ttatctgcggagcaacttaaagccttcacattacctatgattttccctgattgggccgtg
cattga

DBGET integrated database retrieval system