KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE0551Help
Entry
YE0551            CDS       T00469                                 

Gene name
scrB
Definition
(RefSeq) sucrose-6-phosphate hydrolase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    YE0551 (scrB)
   00500 Starch and sucrose metabolism
    YE0551 (scrB)
Enzymes [BR:yen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     YE0551 (scrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(632013..633422)
Genome map
AA seq 469 aa AA seqDB search
MQEASLLKHLTLAVMRGQGRALQDPHRPGWHLAPCVGLLNDPNGFIYHAGYYHLFYQWNP
LDCRHGSKYWGHWRSTDLVHWEHQPVALVPSEAYESHGCYSGSAVIADDLITLIYTGNVK
YPDGSRTAFQCLAQENERGEFDKLGPVLPLPAGYTGHVRDPKVWQHDGQWYMVLGAQDQQ
LQGKVLLLRSGDLREWHNLGEIAGSGLGGLGPFGYMWECPDLFTLADKDVLIFCPQGIPA
EAERYRNTFQAGYLLGKLDYANTTFNHQAFHELDAGFEFYAPQTTLAADGRRLLFGWMGI
PDEDEFYQPTVEYGWIHTMTCPRELSLNGDKLIQQPARELAALRCEHTQWQGRAQEAPAL
AIGSAEMIIDVSAPFTLELGNTLLLEWDDACLILSRNNLRTGLREFRYWRGQLQQLQLLC
DRCSIEIFINQGQAVMTSSYFPPVPPQAIFTGSAELRVQHWLLSSPMLE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaagccagtttgcttaaacatcttacgctggcagtgatgcgcggtcagggccgc
gcattacaagacccacaccggccgggctggcacttagctccctgtgtcgggttgctgaat
gatcccaatgggtttatttatcatgctggctattatcatctgttttatcaatggaatccg
ctggattgccgccacggcagtaaatattggggccactggcgcagcactgacttagtgcat
tgggaacatcaaccagtggcattggtgccaagcgaagcctatgaaagtcatggttgttac
tccggttcggcggtgattgctgatgaccttatcaccttgatttacaccggaaatgtgaaa
taccccgatggctcccgtaccgcattccaatgtctggcacaggaaaatgaacggggcgag
ttcgacaagttagggccagtgctcccattgcccgctggctataccggacatgtgcgtgac
ccgaaagtctggcagcacgacggccagtggtacatggtgttaggcgctcaggaccaacaa
ctacaaggcaaggtgctactgctgcgctctggtgatttacgcgaatggcataacctcggt
gagatagctggctctggtctgggggggcttgggccttttggctatatgtgggaatgcccc
gacctgtttaccctggcagataaagacgttttgattttctgcccacagggtataccagcc
gaagctgaacgctatcgtaatacctttcaggccggctatttactgggcaaattagattat
gccaacaccaccttcaatcatcaggcattccacgagttggacgctggctttgagttctat
gcgccgcaaaccacgctagccgcagatggtcgtcgcttattattcggctggatgggcatt
ccagatgaagatgaattttatcaaccaacagtggaatatggctggatccacaccatgact
tgcccacgcgagttgagtcttaatggcgacaaactgattcagcaaccggcccgtgagtta
gccgcgctgcggtgtgaacatacgcagtggcaaggccgtgcccaagaagcccctgctctt
gcgatcggtagcgccgaaatgataatcgacgtcagtgcgccttttaccctcgaattgggc
aatacattgctgttggaatgggatgatgcgtgcttgattttaagccgtaataatctgcgc
accggattgcgggaattccgttactggcgcggtcaactgcaacaattacagttactttgt
gatcgttgcagcatagagatttttatcaatcagggacaagcggtgatgacgtcgagttac
ttcccaccagtaccgccacaagccatttttacgggaagtgctgaactgcgagtgcaacac
tggctgttgtcttcgcccatgttagaatga

DBGET integrated database retrieval system