KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE0571Help
Entry
YE0571            CDS       T00469                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    YE0571 (deoA)
Enzymes [BR:yen01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     YE0571 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
656425..657747
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGQALSEEEIRFFINGIRDNVVSEGQIAALAMTIYFHDMSMPERVALT
MAMRDSGTVLNWKSLNLNGPMVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDSAFRKIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYQLSEDLAKAIVGVANGAGCKTTALLT
DMNQVLASSAGNAVEVREAVRFLTGEYRNPRLLEVTMALCVEMLLSGGLAQNDADARAKL
QAVLDNGKAAEIFGRMVAAQKGPSDFVERYDSYLPAAMLSKPVFAERSGIITAMDTRALG
MAVVSLGGGRRRATDPIDYSVGLTEMARLGASVDGQQPLAVIHANNEDDWQQAADAVRAA
ITLGQKAAEETPVVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctcgcacaagaaattatccgtaaaaaacgtgacggccaggcactgagcgaagaa
gagattcgtttctttattaatggcattcgcgataacgtggtttccgaagggcaaattgct
gctctggcgatgaccatttatttccatgatatgagcatgccagaacgtgtggcgctcact
atggcaatgcgtgattctggcaccgtgctgaactggaagagcctaaaccttaatggcccg
atggtggacaagcactccaccggcggcgtgggtgatgtgacttccttgatgctcggccca
atggtagcggcctgcggcggctatgtaccgatgatctcgggtcgtggcttgggtcatacc
ggcggaacattggacaaactggaagcgattcctggttttgatattttccccgacgacagt
gcctttcgcaaaatcattcaggatgtcggcgtcgctattatcggccaaaccagctcgctg
gcaccggcggataagcgcttttatgccacccgcgatatcaccgctacggtagattctatc
ccgctgattaccgcttctattctggctaaaaagctggctgaagggttggatgcgttggtg
atggatgtcaaagtggggtcgggtgcttttatgccgacttatcagctgtctgaggacttg
gccaaggccattgtcggtgtcgctaatggcgcgggttgtaaaaccacagcgctgttgact
gacatgaatcaggtattggcgtccagtgccggtaatgcggttgaagtgcgcgaagcggtg
cgtttcttgactggcgaatatcgtaacccgcgtctgttggaagtgactatggcgctgtgt
gtcgagatgctgctatccggcggcttggcgcaaaatgatgccgatgctcgtgctaagctg
caagcagtattggataacggcaaagcggcggaaatcttcggtcgcatggtcgctgcgcaa
aaaggcccgagcgattttgtcgaacgctatgacagttacttgccagccgccatgttaagc
aagcccgtatttgctgaacggtcaggaattatcactgctatggatacccgagcattaggt
atggccgtagtttcccttggcggtggtcgccgtcgggcaactgatcctattgactacagt
gtgggcctgaccgagatggcccgcttgggagccagtgttgatggtcaacagccattagcg
gtgattcatgccaacaatgaagatgactggcagcaggcagcagatgcagtacgtgcggca
atcacattaggccaaaaagcagcggaagaaaccccggtggtttatcgccgtattactgaa
taa

DBGET integrated database retrieval system