KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE0602Help
Entry
YE0602            CDS       T00469                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
yen00260  Glycine, serine and threonine metabolism
yen00750  Vitamin B6 metabolism
yen01100  Metabolic pathways
yen01110  Biosynthesis of secondary metabolites
yen01120  Microbial metabolism in diverse environments
yen01230  Biosynthesis of amino acids
Module
yen_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YE0602 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    YE0602 (thrC)
Enzymes [BR:yen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     YE0602 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-GeneID: 4713439
NCBI-ProteinID: YP_001004956
UniProt: A1JJC8
Position
690648..691937
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAIKQGLGKQQGLFFPLELPEFELTEIDKLLDLDFVTRSSRILS
AFIGNEIAPEVLTKRVQAAFEFPAPVAQVENDIAALELFHGPTLAFKDFGARFMAQMLAE
VAGDQPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPRGKISPLQEKLFCTLGGNIHTV
AIEGDFDACQALVKQAFDDEELKQALSLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLVNGQWQPKPTVATLSNA
MDVSQPNNWPRVEELYRRKIWQLKELGHGAVSDDVTKDTMRELAELGYISEPHAAIAYRV
LRDQLQDGEFGVFIATAHPAKFKESVEEILAQELPLPKPLAVRAQLPLLSHDLPADFAQL
RAFLMALPK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataaccttaaagatcacaacgaacaggtcagcttcgcgcaagcgatcaaa
cagggcctgggcaagcagcaagggttgttcttcccgctggagttgccagagtttgaactg
acagaaattgataaactgctggatctggattttgtcactcgcagcagccgtattctttct
gcttttattggtaatgaaatcgcaccagaggtgttaaccaaacgcgttcaggcggcgttt
gagtttccggctccagtcgctcaggttgagaatgatatcgccgcactggagttgttccac
ggcccgacattggcctttaaggacttcggcgcacgttttatggcacaaatgctggccgaa
gtggctggcgaccagccagtgactatcttaaccgcaacctctggtgatactggggcggcg
gtcgctcatgctttctatggcttgaaaaatgttcgcgtggttatcctctatccacgcggc
aaaatcagcccgctgcaagagaagctgttctgtacgttaggtggcaatatccacacggtg
gctattgagggcgattttgatgcttgtcaggcgctggtcaaacaagcctttgatgatgag
gagttaaagcaggcgctgagccttaactctgctaactccattaatatcagccgcttgctg
gctcagatttgctattacttcgaagctgtagcccagttaccgcaagaagcacgtaaccaa
ttggttatctcagtgccaagtggcaacttcggtgatttgaccgccggtttgctggcaaaa
tcgttaggtttgccggtaaaacgctttatcgctgccactaatgccaacgacaccgtgccg
cgcttcctggttaacggccagtggcagccgaagccgacggtggcgacgttatcgaatgct
atggatgtcagccagccgaataactggccgcgtgttgaggagctttatcgtcgtaaaatc
tggcagttgaaagaattgggccacggcgcagtcagtgatgatgtcactaaagacaccatg
cgcgaattggcggagttagggtatatctcagagcctcatgctgctattgcctatcgtgtg
ttgcgcgatcaattgcaggacggggaattcggggtatttatcgcgacagcgcatccggcg
aaattcaaagaaagtgtagaagagattctggcgcaggaattgccgctgccaaaaccactg
gcagtgcgggcacaattaccgctgctatctcatgatttgccagcagactttgcgcaactg
cgagctttcttgatggctttgccaaagtaa

DBGET integrated database retrieval system