KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE0701Help
Entry
YE0701            CDS       T00469                                 

Gene name
aceF
Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
yen00010  Glycolysis / Gluconeogenesis
yen00020  Citrate cycle (TCA cycle)
yen00620  Pyruvate metabolism
yen01100  Metabolic pathways
yen01110  Biosynthesis of secondary metabolites
yen01120  Microbial metabolism in diverse environments
yen01130  Biosynthesis of antibiotics
yen01200  Carbon metabolism
Module
yen_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YE0701 (aceF)
   00020 Citrate cycle (TCA cycle)
    YE0701 (aceF)
   00620 Pyruvate metabolism
    YE0701 (aceF)
Enzymes [BR:yen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     YE0701 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA
Motif
Other DBs
NCBI-GeneID: 4715860
NCBI-ProteinID: YP_001005046
UniProt: A1JJL9
Position
812153..814030
Genome map
AA seq 625 aa AA seqDB search
MSIEIKVPDIGADEVEVTEIMVKVGDTVEAEQSLITVEGDKASMEVPSPQAGVVKEIKIA
VGDTVATGKLMMIFEATGAAAAPAKAEEKSAAPAPAAAPAALAVKNVEVPDIGGDEVEVT
EVMVKVGDTVAAEQSLITVEGDKASMEVPAPFAGTVKEIKINTGDKVSTGSLIMVFEVAG
AAAPAAATESAPAAPAAPAASAAKNVEVPDIGGDEVEVTEVMVKVGDKVAAEQSLITVEG
DKASMEVPAPFAGIVKEIKINTGDKVKTGSLIMVFEVEGAAPAAAPAQQAAPAAAPAKAA
AVSAPTASNSKGEFAENDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRILREDVQAYVK
DAVKRAEAAPAAATGGGLPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWVMIPH
VTHFDKTDITDLEAFRKLQNDEAAKRKLDVKFTPVVFIMKAVAAALEQMPRFNSSLSEDG
QKLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSITELSRELMAISKKARDGKLTAGEMQG
GCFTISSLGGIGTTHFAPIVNAPEVAILGVSKSAIEPVWNGKEFQPRLMMPMSLSFDHRV
IDGADGARFITIINNMLADIRRLVM
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcgaaatcaaagtaccggacatcggtgcagatgaagttgaagtcaccgaaatt
atggtgaaagtgggtgataccgttgaagctgagcaatcacttatcactgttgaaggtgat
aaagcttctatggaagtcccttcaccacaggcaggtgtggttaaagaaatcaaaattgcg
gttggcgatactgttgcaaccggcaaactgatgatgatcttcgaagcaacaggtgccgct
gcggcacctgctaaagcggaagagaaatcagcggcccctgctccggcagcggctcctgca
gcattggctgttaaaaatgttgaagtaccagatatcggcggtgatgaagttgaagtcact
gaagtgatggtcaaagtgggcgacactgttgcggctgaacaatctcttatcacggtagag
ggcgataaagcttctatggaagtgcctgcgccattcgccggtacggttaaagagatcaaa
atcaacactggtgataaagtcagcactggttctctgattatggtatttgaagtggcaggt
gcagcggcacccgctgcggcaactgagtcagcaccggcagctcctgctgcaccggctgcc
tctgctgccaaaaatgttgaagtaccagacattggtggtgatgaagttgaagtcacagaa
gtgatggtgaaagtgggcgataaagttgccgctgaacaatcactgattaccgttgaaggt
gataaagcttcgatggaagttccggcacccttcgcgggcatcgtgaaagagatcaaaatt
aacaccggcgacaaagtgaaaaccggttctctgatcatggtgtttgaagtggaaggcgcg
gcacctgctgctgcaccagcccagcaagccgcacctgccgctgcgccggccaaagccgct
gctgtatcggcaccaactgccagcaacagtaaaggcgaattcgctgagaatgatgcttac
gtgcatgcaacgccggttatccgtcgtttggcccgtgaatttggcgtaaatctggcgaaa
gtgaaaggtactggtcgtaaaggccgtatcctgcgcgaagacgttcaggcttatgtgaaa
gatgcggtcaaacgtgctgaagcggctcccgcagctgccaccggtggtggtctgccaggc
atgctgccttggccgaaagttgatttcagcaagtttggcgaaatcgaagaagtggaattg
ggtcgtatccagaaaatctctggcgctaacttgagccgtaactgggtcatgattccacat
gtcactcacttcgacaaaaccgatatcaccgatctggaagcgttccgtaagctgcagaac
gacgaagctgctaagcgtaagctggacgtgaagttcaccccagtggtgttcatcatgaaa
gctgttgctgctgccctcgagcagatgccacgtttcaacagctcactgtccgaagatggc
cagaagttgacgctgaaaaagtacatcaatatcggtgttgcggtagatacgccaaatggt
ttggtcgttccggtattcaaggatgtgaacaagaaaagcatcactgaactgtcccgtgaa
ctgatggctatctcgaagaaagctcgtgatggcaagctgaccgctggcgaaatgcagggc
ggttgcttcaccatctccagcttgggcggtatcgggacaactcacttcgcgccgattgtt
aacgcgccggaagtggctatcttgggtgtctccaagtctgcgatagagccagtctggaac
ggtaaagagttccagccgcgtctgatgatgccgatgtcgctctccttcgaccaccgtgtg
atagacggtgctgatggtgcgcgctttatcactatcatcaacaatatgctggctgacatt
cgccgtctggtgatgtaa

DBGET integrated database retrieval system