KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE0958Help
Entry
YE0958            CDS       T00469                                 

Definition
(RefSeq) urea transporter
  KO
K08717  
urea transporter
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Brite
Transporters [BR:yen02000]
 Other Transporters
  Pores ion channels [TC:1]
   YE0958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1081767..1082756
Genome map
AA seq 329 aa AA seqDB search
MNAKTGNQSGWAQLSASNVFIEFIDTTLRGCAQVMFQNNPLTGLFFFIAIFVGAYGEGNP
AVAYGCVLGTIVATLTGLTMRDRKSWRSGLYGYNGCLVGAALPTFLVATPIVWACIVLGS
IVSVIVMVCIADILKTWKVAALTAPFVLTTWMILLASYAFAGLHSSGLPTPALPHPLVLD
SGATASGNLFVSMFNGVSQVFLFSSLIGGILFIIGLAVESLWAAVFAVGGSLLALFTAIF
LGANPSSIDAGLYAFSAVLTAIALGSTFNKPSWRVLAYTIVGVIFTVIVQGALNILLSPI
GIPTLTMPFVLASWLFLVPNKDVMPAHRQ
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgaaaacgggcaatcaatccggctgggcacaacttagtgcttcgaatgttttc
attgaatttatcgatacaacgctgcgcggctgtgctcaagtcatgttccagaataaccct
ctgaccgggctattcttttttatcgcaatatttgtcggagcctatggcgaagggaacccg
gcggtggcttatggttgtgtgctgggaacaatagtggcaacactcaccgggctaacgatg
cgcgatcgtaaatcatggcgctcagggttatacggctataacgggtgtttggtgggggcg
gcattaccgacatttttggttgccacaccgatagtctgggcatgcattgttttaggtagc
atcgtgtcggtcattgttatggtttgtatcgccgatattttaaaaacttggaaagttgcg
gcattaactgcaccttttgttctcactacctggatgatcttgttggccagttacgccttt
gccggtttacatagcagtggattacctaccccggctctacctcatccgttggttttagat
agtggagcaactgcgagtggtaatcttttcgtcagcatgttcaatggtgtttctcaggta
tttttattcagtagtttgattggcggcattctttttatcatcgggctggcggttgaatcg
ctctgggccgccgtatttgccgtgggtggttcactattggcgcttttcaccgctatattc
cttggagcaaacccgagcagtattgatgccggactttatgcattcagtgcggtattgacg
gcgatcgctttaggttcgacatttaacaagcccagttggcgcgttttggcttataccatc
gtcggcgttatttttacggtcatcgtacagggcgctctgaatattttattgtcccctatc
ggtattccaaccttgacgatgccatttgttctcgcttcatggttattcctggttcctaat
aaagatgtgatgccagcacatagacaatag

DBGET integrated database retrieval system