KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE1257Help
Entry
YE1257            CDS       T00469                                 

Gene name
ascB
Definition
cryptic 6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YE1257 (ascB)
Enzymes [BR:yen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     YE1257 (ascB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1401361..1402791
Genome map
AA seq 476 aa AA seqDB search
MSVSTFPDGFLWGGALAANQAEGACFEGGKGLATVDMIPHGEHRLAVKLGQEKRFTLRDD
EFYPSHQAIDFYHRYKDDIALMAEMGFTVFRTSIAWSRIYPNGDELTPNAEGIAFYRDLF
NECKKHNIEPLVTLCHFDVPMHLVTEYGSWRNRKMVEFFTRYARTCFEAFDGLVKYWLTF
NEINILLHSPFSGAGLVFEPNENQEQVKYQAAHHELLASALATKIAHEVNPENQVGCMLA
GGNFYPRTCKPEDVWAALEKDRENLFFIDVQARGAYPAYTKRLFREKGISIATQVGDDDI
LKHEVDFVSFSYYASRCASADMNEHNSSAANIVKSLKNPHIQASEWGWGIDPLGLRVTMN
MMYDRYQKPLFLVENGLGAKDEINPLGEIEDDYRISYLREHIKAMAEAIDDGIPVIGYTS
WGCIDLVSASTGEMSKRYGFVYVDRDDLGNGSLARKKKKSFYWYKKVIASNGADLS
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtatcaacatttcccgacggttttttatggggcggcgcattagccgcaaaccag
gccgaaggtgcttgttttgaaggtggaaaagggctggcaacggtggatatgatccctcat
ggggaacaccgtttggcagtgaaattagggcaggaaaagcgttttaccttaagagatgat
gagttttaccctagtcatcaggccattgatttttatcatcgctataaagatgatatcgcg
ttaatggcagaaatggggtttaccgtattccgtacatcaattgcatggagccggatttac
cctaatggcgatgaattgacaccgaatgccgagggcattgccttttatcgcgacctcttt
aatgaatgcaagaagcacaatattgagccgctggtaacactgtgtcactttgatgtaccc
atgcatctggtcacggaatatggctcgtggcgtaaccgaaaaatggttgagttttttacg
cgttatgcccgaacatgttttgaggccttcgatggtttggtgaaatattggctcacattt
aacgaaattaatatcctgcttcatagcccattttcaggtgctggtttggtttttgagccg
aatgaaaatcaggaacaggtaaaataccaagctgctcatcacgaactgctcgccagtgca
ttagcgactaaaattgctcatgaggtcaatcctgagaatcaggtaggttgcatgctggcg
ggagggaatttttatccgcgaacctgtaaacccgaagatgtttgggccgcgctggaaaaa
gatagggaaaatctattttttattgatgtgcaggcccgtggggcttatcccgcttataca
aaacgccttttcagagagaagggaatttcaattgccacccaagtgggtgatgacgatatt
cttaaacatgaggtggatttcgtctctttcagttattacgcttcgcgttgtgcttcggcg
gatatgaatgagcataacagcagcgcagctaatattgtgaaatctttgaaaaatccacat
attcaagccagtgaatggggctggggcattgatcctttaggtttacgcgtcaccatgaat
atgatgtatgaccgttaccagaagccactatttctggttgaaaatggattaggtgctaag
gatgaaattaatccgctgggcgaaattgaagacgattaccgtattagttatctacgtgaa
catattaaagctatggcggaagctatcgacgatggcattccggtcatcggatatacctca
tggggatgtatcgatttagtttctgcgtcaactggagaaatgagcaaacgctatggattt
gtttatgttgatcgtgacgatttgggcaacggttctttagcacgcaagaaaaagaaatct
ttctattggtataaaaaagtcattgccagtaatggtgctgatttgagttaa

DBGET integrated database retrieval system