KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE1277Help
Entry
YE1277            CDS       T00469                                 

Gene name
fadJ
Definition
(RefSeq) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
yen00071  Fatty acid degradation
yen00280  Valine, leucine and isoleucine degradation
yen00281  Geraniol degradation
yen00310  Lysine degradation
yen00362  Benzoate degradation
yen00380  Tryptophan metabolism
yen00410  beta-Alanine metabolism
yen00640  Propanoate metabolism
yen00650  Butanoate metabolism
yen00903  Limonene and pinene degradation
yen00930  Caprolactam degradation
yen01040  Biosynthesis of unsaturated fatty acids
yen01100  Metabolic pathways
yen01110  Biosynthesis of secondary metabolites
yen01120  Microbial metabolism in diverse environments
yen01130  Biosynthesis of antibiotics
yen01200  Carbon metabolism
yen01212  Fatty acid metabolism
Module
yen_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    YE1277 (fadJ)
   00650 Butanoate metabolism
    YE1277 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    YE1277 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    YE1277 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YE1277 (fadJ)
   00310 Lysine degradation
    YE1277 (fadJ)
   00380 Tryptophan metabolism
    YE1277 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YE1277 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    YE1277 (fadJ)
   00281 Geraniol degradation
    YE1277 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YE1277 (fadJ)
   00930 Caprolactam degradation
    YE1277 (fadJ)
Enzymes [BR:yen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     YE1277 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     YE1277 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     YE1277 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 4715636
NCBI-ProteinID: YP_001005598
UniProt: A1JK30
Position
1419523..1421622
Genome map
AA seq 699 aa AA seqDB search
MNTLKAKFAEQIAEILQQAQALSQLQGLVIISGKPDSFIAGADITMIAACHTAQDARILA
QKGQSILAQIAAFPVPVVAAIHGACLGGGLELALACHSRICSQDDKTVLGLPEVQLGLLP
GSGGTQRLPRLVGVSKALDMILTGRQVRARQALKMGLVDDVVPQDILLDVAIQRAKAGWL
DKPALPWQERLLSGPLGKALLFNIVRKKTQAKTKGHYPAAERIIDVVRKGLDHGGPAGYE
AEAKAFGELAMTPESAALRSLFFATTSLKKESGGKAQPRAIHRVGVLGGGLMGGGIANVT
ATRAGLPVRIKDINPTGINQALKYTWDTLGKRVRSKRMRPAERQRQMMLISGSTDYCGFG
NVDIVVEAVFEDLSLKQQMVADIEHFAAPHTIFASNTSSLPISDIAAQAQRPEQVIGLHY
FSPVDKMPLVEVIPHAKTSEETIATTVALARKQGKTAIVVADRAGFYVNRILAPYINEAA
RCLLDGEPIASVDKALVDFGFPVGPITLLDEVGIDVGTKIIPILVEKLGARFAAPPSFDV
ILKDGRKGRKNGRGFYLYPAKSSGFKWKRSPVKQVDTSVYTLLGVTPKAHLESAVIAQRC
TMMMLNEAARCLDESIIRNPRDGDIGAVFGIGFPPFLGGPFRYMDSLGADKVVKTLNLLA
QQYGERFEPCSLLVTMAGQQKRFYPPENSLDEAAITAHN
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaccttaaaagctaaattcgcagaacaaattgctgaaatactgcaacaagcacag
gccttgagccaattacagggattagtgattatttctggtaaaccggactcttttatcgct
ggtgctgatatcaccatgattgccgcttgtcacactgcgcaggatgcccgaattttggcc
cagaaaggtcaatccattctggcacaaatcgcggcattccctgtgccggtagttgccgct
atccacggtgcttgtcttggtggtggtttggaactggcgctggcatgccatagccgaatt
tgctcacaggatgataaaaccgtactcggcttgccagaggtgcaattggggctgctgcct
ggttcgggaggcactcagcgtttgccgcgtctggtgggggtcagtaaggcgctggatatg
atattaacgggcaggcaggttcgtgcgcgacaggcacttaaaatggggctggtggacgat
gtagtaccacaggacatcttgcttgatgtggctattcagcgggcaaaagccggttggctt
gataagcctgccttgccgtggcaggaacgtttactcagtggcccgctaggtaaggcactg
ttatttaacatcgttcgtaagaaaactcaggcaaagaccaaaggtcattatcctgcggca
gagcgtattattgatgtagtacgtaaagggttagaccacggcggccctgcgggttatgaa
gccgaagccaaggcttttggtgagttggcgatgacccctgagtcagccgcattacgcagc
ttgttttttgcaaccacctcgctgaaaaaagagagtggcggtaaagcgcaacctcgtgcg
atccatcgtgtgggagtcttaggggggggcttgatggggggcggtattgctaatgtcacg
gcaacccgtgcggggttgccggtacggattaaagatatcaatccaaccggaattaatcag
gcgctgaaatatacctgggatactttaggcaagcgggtgcgcagtaaacggatgcgtccg
gctgagcggcaacggcagatgatgctgatttccggcagcaccgattattgtggttttggc
aatgtggatattgtggttgaagcggtatttgaagatttatcgttgaaacagcagatggtg
gcagatattgagcatttcgcggctcctcacactatttttgcctctaacacatcatctctg
ccaatcagcgacatcgcggcacaggcacagcggccggagcaggtcatcggcctgcattac
tttagtccggtggataaaatgccgctggtggaagttattccacatgcaaaaacgagcgaa
gaaaccattgcaaccacggttgctttagcgcgcaaacagggtaaaacagcgatcgtggtt
gctgatcgtgccggattctatgtaaatcgtattttggctccgtatatcaatgaagcagcc
cgctgcctattagacggtgaacctatcgcttcagttgataaagccctggtcgattttggc
ttcccggttggcccgataaccttgctggatgaagtgggaattgatgtgggcaccaaaata
atacctattctggtggagaaattaggggcacgttttgccgcaccgccttcttttgatgtc
atcttgaaggatgggcggaaagggcgtaaaaatggtcgcggtttctacctttatcccgct
aaaagtagcggttttaagtggaaaagaagtcccgtcaagcaagtggacactagcgtgtat
accttactgggtgtcacaccgaaggcgcatcttgaatctgcggtgatagcacagcgctgc
acgatgatgatgctgaatgaagccgcgcgttgtctggatgaatccatcattcgtaatccg
cgcgatggggatattggtgctgtgttcgggattggtttccctccgttcttgggcgggcct
ttccgctatatggacagtctgggcgcagataaagtggtaaaaacactgaatttacttgcc
cagcaatatggcgagcgttttgagccttgctcattattggtcacgatggctgggcagcaa
aaaaggttttatccacctgaaaacagtttggatgaagcggccattaccgcacataattaa

DBGET integrated database retrieval system