KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE1417Help
Entry
YE1417            CDS       T00469                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:yen00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1588343..1589779
Genome map
AA seq 478 aa AA seqDB search
MSHKQLPKDFLWGGAVAAHQVEGGWDKGGKGVSIADVLSGGAHGVDRVMTDGVQEGYRYP
NHEAVDFYGHYKEDIALFAEMGFKCFRTSIAWTRIFPKGDELQPNEAGLQFYDDMFDELL
KYGIEPVITLSHFEMPWHLVKEYGGWKNRKVVDFFVKFSEVVMERYKSKVKYWMTFNEIN
NQRNWKYPLFGYCCSGVVFTEQENPEETMYQVLHHQFVASAKVVKLGHAINPEFKIGCMV
AMVPLYPFSCHPDDMMYSVEAMRERYLFGDVHMRGYYPSYILNEWERRGFTINMEEGDLD
TLREGCADYMGLSYYMSNAVSAVNPGSGNSLSGFEGSVPNPHVKASDWGWQIDPVGLRYS
LSVLYERYQKPLFIVENGFGAIDKVADDGMVHDDYRIAYLKAHIEQMKKAVFEDGVDLMG
YTPWGCIDCVSFTTGEYSKRYGFIYVDKNDDGTGTMARSRKQSFDWYKKVIASNGEEL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagccacaaacaattaccgaaagattttttatggggcggcgcagttgcggcacatcag
gttgaaggcggctgggataaaggcggcaaaggtgtaagcattgccgatgtattgtccggt
ggcgctcacggcgttgaccgagttatgactgatggtgtgcaagaaggttatcgctatcca
aaccatgaagcggttgatttttatggtcattataaagaagacatcgcgctgtttgccgaa
atgggcttcaaatgcttccgtacttccattgcctggacgcgtattttcccgaagggtgat
gagttgcaaccgaatgaagcgggtctgcaattttacgatgatatgtttgatgagctgtta
aaatacggtatcgaaccggttattacgctatctcattttgaaatgccgtggcacttggtt
aaagaatacggtggctggaaaaatcgtaaagtggtcgactttttcgtgaaattcagtgaa
gtggtcatggagcgctacaagagcaaagtcaaatattggatgacattcaacgagatcaat
aaccaacgtaactggaaatatccactatttggttactgctgctctggagtggttttcact
gagcaagaaaatcctgaagaaacgatgtatcaggttctgcatcatcagtttgttgccagt
gccaaagttgtcaaattgggccacgctattaatccagaattcaagattggctgtatggtc
gcgatggtgccgctctatccattctcctgccatccagatgacatgatgtattcggtggag
gctatgcgtgagcgttatctattcggtgacgtccacatgcgtggttactacccttcatat
attctgaatgaatgggagcgccgcggtttcactatcaatatggaagagggtgaccttgat
actctacgtgagggctgcgccgattacatgggcttaagctattacatgagtaacgcagtt
tctgcggttaatcccggtagcggcaactccctttctggctttgagggcagtgtacctaat
ccacatgttaaagcatccgattggggatggcagatcgatcccgtcggcttgcgttattca
ctgagcgtattgtatgaacgttaccagaagccgctgtttattgttgaaaatggttttggt
gctatcgacaaagtggctgatgacggtatggttcatgatgattaccgcattgcgtatctt
aaagcccatattgagcagatgaaaaaagcagtgtttgaagatggcgtagacctgatgggc
tacaccccgtggggttgtatcgattgtgtatcattcacaaccggtgaatacagcaagcgt
tatggttttatctacgtggataaaaacgatgacggcaccggcaccatggcgcgttcacgt
aaacaaagttttgactggtataaaaaagtgattgccagcaatggtgaagagctttaa

DBGET integrated database retrieval system