KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE1417Help
Entry
YE1417            CDS       T00469                                 

Gene name
bglA
Definition
(RefSeq) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
yen00010  Glycolysis / Gluconeogenesis
yen00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YE1417 (bglA)
   00500 Starch and sucrose metabolism
    YE1417 (bglA)
Enzymes [BR:yen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     YE1417 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 4714496
NCBI-ProteinID: YP_001005725
UniProt: A1JLL0
Position
1588343..1589779
Genome map
AA seq 478 aa AA seqDB search
MSHKQLPKDFLWGGAVAAHQVEGGWDKGGKGVSIADVLSGGAHGVDRVMTDGVQEGYRYP
NHEAVDFYGHYKEDIALFAEMGFKCFRTSIAWTRIFPKGDELQPNEAGLQFYDDMFDELL
KYGIEPVITLSHFEMPWHLVKEYGGWKNRKVVDFFVKFSEVVMERYKSKVKYWMTFNEIN
NQRNWKYPLFGYCCSGVVFTEQENPEETMYQVLHHQFVASAKVVKLGHAINPEFKIGCMV
AMVPLYPFSCHPDDMMYSVEAMRERYLFGDVHMRGYYPSYILNEWERRGFTINMEEGDLD
TLREGCADYMGLSYYMSNAVSAVNPGSGNSLSGFEGSVPNPHVKASDWGWQIDPVGLRYS
LSVLYERYQKPLFIVENGFGAIDKVADDGMVHDDYRIAYLKAHIEQMKKAVFEDGVDLMG
YTPWGCIDCVSFTTGEYSKRYGFIYVDKNDDGTGTMARSRKQSFDWYKKVIASNGEEL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagccacaaacaattaccgaaagattttttatggggcggcgcagttgcggcacatcag
gttgaaggcggctgggataaaggcggcaaaggtgtaagcattgccgatgtattgtccggt
ggcgctcacggcgttgaccgagttatgactgatggtgtgcaagaaggttatcgctatcca
aaccatgaagcggttgatttttatggtcattataaagaagacatcgcgctgtttgccgaa
atgggcttcaaatgcttccgtacttccattgcctggacgcgtattttcccgaagggtgat
gagttgcaaccgaatgaagcgggtctgcaattttacgatgatatgtttgatgagctgtta
aaatacggtatcgaaccggttattacgctatctcattttgaaatgccgtggcacttggtt
aaagaatacggtggctggaaaaatcgtaaagtggtcgactttttcgtgaaattcagtgaa
gtggtcatggagcgctacaagagcaaagtcaaatattggatgacattcaacgagatcaat
aaccaacgtaactggaaatatccactatttggttactgctgctctggagtggttttcact
gagcaagaaaatcctgaagaaacgatgtatcaggttctgcatcatcagtttgttgccagt
gccaaagttgtcaaattgggccacgctattaatccagaattcaagattggctgtatggtc
gcgatggtgccgctctatccattctcctgccatccagatgacatgatgtattcggtggag
gctatgcgtgagcgttatctattcggtgacgtccacatgcgtggttactacccttcatat
attctgaatgaatgggagcgccgcggtttcactatcaatatggaagagggtgaccttgat
actctacgtgagggctgcgccgattacatgggcttaagctattacatgagtaacgcagtt
tctgcggttaatcccggtagcggcaactccctttctggctttgagggcagtgtacctaat
ccacatgttaaagcatccgattggggatggcagatcgatcccgtcggcttgcgttattca
ctgagcgtattgtatgaacgttaccagaagccgctgtttattgttgaaaatggttttggt
gctatcgacaaagtggctgatgacggtatggttcatgatgattaccgcattgcgtatctt
aaagcccatattgagcagatgaaaaaagcagtgtttgaagatggcgtagacctgatgggc
tacaccccgtggggttgtatcgattgtgtatcattcacaaccggtgaatacagcaagcgt
tatggttttatctacgtggataaaaacgatgacggcaccggcaccatggcgcgttcacgt
aaacaaagttttgactggtataaaaaagtgattgccagcaatggtgaagagctttaa

DBGET integrated database retrieval system