KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE1705Help
Entry
YE1705            CDS       T00469                                 

Gene name
ycfO
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YE1705 (ycfO)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    YE1705 (ycfO)
Enzymes [BR:yen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     YE1705 (ycfO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1899737..1900762
Genome map
AA seq 341 aa AA seqDB search
MGPVMLDVASYELDAEEREILKHPLVGGLILFSRNFHDAAQLRELVRQIRAASHERLVVA
VDQEGGRVQRFRDGFTRLPEAQSFAAINDAATAAQLAQDAGWLMAAEMISMDIDISFAPV
LDIGHVSAAIGERSFHSDPQQALKMAECFIRGMHSAGMKTTGKHFPGHGAVTADSHKETP
RDNRPLAEIRTHDMVIFRELIARRLLDAIMPAHVIYTEADARPASGSSYWLQTILRQELG
FDGIIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRQGAVSVLDNLSPVKADQL
ACLYHSGQFDRQALMASPRWQQANKALTALSERWDAHKSRG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgggtccagtaatgttagacgttgccagctatgagctggatgcagaagaacgtgagatt
ttaaagcacccgctggtgggcggcctgattttattcagccgtaattttcatgatgccgcg
caactacgcgagttagtccgccagataagggcggcatcccatgagcgcttagtggtggcg
gttgatcaggaaggggggcgcgtacagcgtttccgtgatggttttacccgcttacctgag
gctcagtcgtttgcggcgatcaatgatgcagctactgcggcgcagttagcacaagatgcg
ggctggctgatggcggccgaaatgatatcaatggatatcgatattagctttgcgccagta
ctggatattggtcatgtcagcgcggctatcggcgagcgttcattccacagtgacccgcaa
caagcattgaaaatggcagagtgttttattcgtgggatgcacagcgcgggtatgaaaacc
accggtaagcacttccccgggcatggggcggtgacggcagattcacataaagagacgcct
cgggataatcgaccactggcagaaatccgcactcatgatatggttatatttcgcgaactg
attgcgcggcgattactggatgccattatgcctgctcatgtgatttatactgaagctgat
gcgcgtccagccagtggttcgtcttactggctgcaaaccatattgcgccaagagttaggg
ttcgatggcatcattttctctgatgacttgtcgatggaaggggcagccatcatgggcagt
tatgccgagcgtgggcaagcctctttggatgcaggctgcgatatgattttggtgtgtaat
aaccgtcagggcgcggtaagtgtgttggataacctgtcgccagtcaaagcagaccaactg
gcatgcttgtatcattctgggcagtttgaccgtcaggcgttgatggcatcaccgcgttgg
caacaggcgaataaggcattaacagcactcagcgaacgttgggatgcacataagtcgcga
ggataa

DBGET integrated database retrieval system