KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE1840Help
Entry
YE1840            CDS       T00469                                 

Definition
bacteriophage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Brite
Enzymes [BR:yen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     YE1840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2022007..2022489
Genome map
AA seq 160 aa AA seqDB search
MSPTLRSQLMGVSAFGSLAIAGVLLGGDDGLEGRKYVAYYDVVNVLTVCDGHTGKDIIPS
KKYSDAECDALLQQDLAPVQRIVDAAVKIPLSQYQKAALYSFTYNVGRHAFIRSTLLKKL
NTGDIKGACDELRRWIYADGQSWKGLQNRREIERELCLTD
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaactcttcgcagtcagttaatgggtgtttctgctttcggatcactggctatt
gccggtgtattactgggtggtgatgatgggttagagggccgtaagtatgtggcttactac
gatgtcgtcaatgtcctcactgtatgcgatggccacactggtaaagatatcatccccagt
aaaaaatattctgatgcggaatgcgatgctttattgcaacaagacttggcgccggtacaa
cgcattgttgatgcagctgtgaaaatcccactaagccaataccagaaagcggctctgtac
tcgttcacctataatgtcggacggcatgcgtttatccgatctacgttgcttaaaaagctc
aatactggcgacatcaaaggcgcttgcgatgagttacgccgctggatatatgctgatggt
cagtcgtggaaagggttgcaaaatcgtcgcgagatagagagggaattatgtctgacagat
taa

DBGET integrated database retrieval system