KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2068Help
Entry
YE2068            CDS       T00469                                 

Gene name
phoA
Definition
(RefSeq) alkaline phosphatase
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Aminobenzoate degradation
Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    YE2068 (phoA)
   00790 Folate biosynthesis
    YE2068 (phoA)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    YE2068 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    YE2068 (phoA)
Enzymes [BR:yen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     YE2068 (phoA)
Exosome [BR:yen04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YE2068 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:yen00537]
 Enzymes
  YE2068 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(2265109..2266518)
Genome map
AA seq 469 aa AA seqDB search
MSGIALSTLILSSSLFAPNAIAAATGLYDRSAHGDVTQFGGARRLTEDQTQALRDSLSNK
TVKNVILLIGDGMGDSEITSARNYAMGAGGFFKGIDALPLTGQYTHYSLDKKTQKPDYVT
DSAASATAWSSGVKTYNGALGVDVFGKDHVTLLELAKKAGKATGNVSTAELQDATPAAQF
AHVTGRKCYGPEETSEKCSTNALENGGRGSITEQMIEGRADVTLGGGSKSFSQLAKAGEW
KDKSLRDQALARGYVIVENLDDLNAIKQADQQKPLLGLFSSGNMPVRWQGPKASYHGNID
KPPVVCENNAERTQGTPTLAVMTEKAIDLLKTNKNGFFLQVEGASIDKQDHAANPCGQFG
ETVDLDEAVQKALEFARADGNTLVIVTADHAHSSQIIEADAKAPGLTQALTTKDGAIMAI
SYGNSEDDSQGHTGTQLRIAAYGPHAANVVGLTDQTDLFFTMRDAMAIK
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
ttgtccggcatagcgttatccaccctgatactgagcagctctctgttcgcccctaatgct
attgccgccgccaccggtttatacgatcgcagcgcccacggtgatgtcactcaatttggt
ggtgctcgccgtttaactgaagaccaaactcaggctcttcgtgattcgctgtccaacaaa
acggtaaaaaatgtcattttactgattggtgatgggatgggtgactcagagataacctcg
gcacgtaactatgctatgggcgcgggtggtttcttcaaagggattgatgcattgccgctg
accggacaatacacgcactattcattagataagaaaacacagaaaccagattatgtgact
gactcggccgcatcggctactgcatggtcttcaggtgtaaaaacctataatggcgctctg
ggtgtcgatgtgttcgggaaagatcacgtcaccctgttggaattggctaaaaaagcaggt
aaagcgactggcaacgtttcaacagctgaactgcaagatgcaacgcctgcggcacaattt
gctcatgttactggccgcaaatgttatggcccggaagaaaccagtgagaagtgcagtact
aatgcgctggagaatggaggccgtggttccatcactgagcaaatgattgaaggacgtgcc
gatgtcaccttgggcggcggctcaaagtcattcagccagttggctaaagcgggtgaatgg
aaagataaatctttgcgtgatcaggcactggctcgcggttatgtgattgtcgaaaacctg
gatgatttgaatgccatcaaacaagcagaccaacaaaaacccctgttggggttattcagt
tctggcaacatgccggtacgttggcaggggccaaaagcctcttatcacggcaatatagat
aagccgcctgtagtttgtgaaaacaacgctgagcgaactcagggtacgccaaccttggcc
gtcatgaccgaaaaggccattgacctgctcaaaaccaacaaaaatggcttcttcttacaa
gtcgaaggggcatcaatcgataaacaagaccacgcggctaatccttgcggccagtttggt
gaaaccgtcgatttggacgaagcagtgcaaaaagcattggaatttgcccgcgcagatggc
aacacactggttatcgtgaccgcagaccatgctcattccagtcaaattattgaggctgat
gccaaagctccgggcctgacccaagctctaaccaccaaagatggcgcaataatggctatc
agttatggcaactcagaagatgattctcaagggcataccggtacacaattgcgcattgcc
gcttacggcccacatgctgcgaatgttgttggtctgacagaccaaactgacctgttcttt
accatgcgcgatgccatggcgattaaataa

DBGET integrated database retrieval system