KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2214Help
Entry
YE2214            CDS       T00469                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YE2214 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YE2214 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YE2214 (trpA)
Enzymes [BR:yen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     YE2214 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2426027..2426833
Genome map
AA seq 268 aa AA seqDB search
MERYQQLFKQLAAKNEGAFVPFVQLGDPTPALSLEIIDTLIAAGADALELGIPFSDPLAD
GPTIQNAALRAFAAGVTPGICFEMLAEIRKKHPTIPIGLLMYANLVFHNGIDTFYQRCAD
VGVDSVLIADVPFEESLPFRTAALRHGIAPIFICPPNADDDLLREIASHGRGYTYLLSRA
GVTGAENHGQLPLNHLIDKLCEYNAAPALQGFGISEPEQVKISLAAGAAGAISGSAIVKI
IENNVSQPAEMLAQLANFVTNMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttatcaacagcttttcaaacagttggctgccaaaaacgaaggcgcatttgtt
cctttcgtgcaactcggcgacccaacaccagctctctccttagaaattatcgacaccttg
attgccgcaggcgctgatgcattggagttgggcattcctttctctgatccattggctgat
ggcccgacgatccaaaacgccgcactacgtgcttttgccgctggtgttacccctggtatc
tgttttgagatgctggcagaaatccgtaaaaagcaccctaccattcccattggattgctg
atgtatgcaaatctggtattccataatgggatagatactttctaccagcgctgcgctgat
gtcggtgtcgactcggtgctgattgctgatgtgccgtttgaagagtctctaccgttccgt
actgcggccttgcgccacgggattgcgcctatctttatctgcccgcctaatgccgatgat
gatttattgcgagaaatagcctctcatggccgtggctatacctatctgctctcccgcgcg
ggtgtgacgggggctgagaatcacggacagctgccattgaatcatttgatagataaactg
tgtgaatacaatgcggctccggctctacaaggttttggtatctcagaacctgagcaggta
aaaatcagtctggcggctggggcagcaggtgccatttcaggttctgctattgtaaaaatc
attgaaaacaatgtctcacagcccgcagagatgctcgcgcaattggccaacttcgtgacc
aatatgaaagcagccacccgcagctag

DBGET integrated database retrieval system