KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2238Help
Entry
YE2238            CDS       T00469                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    YE2238 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YE2238 (adhE)
   00620 Pyruvate metabolism
    YE2238 (adhE)
   00650 Butanoate metabolism
    YE2238 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    YE2238 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    YE2238 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    YE2238 (adhE)
   00626 Naphthalene degradation
    YE2238 (adhE)
Enzymes [BR:yen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     YE2238 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     YE2238 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2448583..2451258
Genome map
AA seq 891 aa AA seqDB search
MAVTNVAELNELVARVKKAQREYANFTQEQVDKIFRAAALAAADARIPLAKLAVEESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILEEDKTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIVFSPHPRAKDATNKAADIVLQAAIAAGAPADIIGWIDAPTVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRVVASILMSKTF
DNGVICASEQSIIVVDSVYDAVRERFASHGGYLLQGKELKAVQDIILKNGGLNAAIVGQP
ATKIAEMAGIKVPANTKILIGEVKVVDESEPFAHEKLSPTLAMYRAKSFEDAVEKAEKLV
EMGGIGHTSCLYTDQDNQPARVKYFGDKMKTARILINTPASHGGIGDLYNFKVAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVATDGAK
RAFIVTDRYLFNNGYADQITSVLKSHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKEFLPASYHEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANAMLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAQKIQKLLAWLDEIKADLGIPASIREAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLISELKQILMDTYYGREFSEELDREEVAVATSAPKAEKKAKK
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacgaatgtcgctgaacttaacgagctagtagcacgcgtcaagaaagcccag
cgcgagtatgccaacttcactcaagagcaggttgataaaatcttccgcgccgcagctctg
gctgctgcagatgcccgtatccctctggctaaattagctgtagaagaatcaggcatgggt
attgtggaagacaaagtgatcaaaaaccactttgcttctgaatacatttacaatgcttac
aaagatgaaaagacttgtggcattctggaagaagataaaacctttggtactatcaccatc
gctgaacctatcggtttgatttgcggtatcgtgccaacgaccaacccaacctctactgct
atcttcaaggcgttaattagcctgaagacccgtaacggtatcgtattctctccacatcct
cgtgcaaaagacgcaaccaataaagccgcagatatcgtgcttcaagccgctatcgcagca
ggtgcgccagccgatatcattggttggattgatgcccctaccgttgagttatcgaaccaa
ctgatgcatcacccagacattaacctgattctggcgaccggtggtccaggcatggttaaa
gcagcttacagttctggtaagccagctatcggtgttggtgcaggtaacacgccagtagtt
gttgatgaaacagcagatatcaaacgtgtagtcgcctctattctgatgtctaaaaccttt
gataacggcgtaatctgtgcgtcagagcagtctatcatcgtcgttgactcagtttatgat
gctgtccgtgagcgcttcgcttcacacggtggctacctgttacaaggcaaagaactgaaa
gctgttcaggatatcatcctgaaaaatggtggactgaacgccgctatcgtgggtcagcca
gcaactaaaattgctgaaatggccggcattaaagttcctgctaataccaagattcttatc
ggcgaagttaaagttgttgatgaatcagagccattcgctcacgaaaaactgtctcctact
ttggcgatgtatcgtgcgaagagcttcgaagacgcagttgaaaaagcagaaaaactggtg
gaaatgggcggtatcggccatacatcttgcctgtatacagaccaggataatcagccagcg
cgcgttaagtatttcggcgataaaatgaaaaccgcccgaatcttaatcaacacgcctgcc
tctcatggtggtatcggtgacctgtataacttcaaagtagcgccgtctctgacgctgggt
tgcggttcttgggggggtaactccatctctgaaaacgtcggtccgaaacacttgatcaac
aagaaaactgtggctaagcgagcagaaaacatgttgtggcataaactcccgaaatctatt
tacttccgccgaggctccctgcctatcgcgttggaagaagtggcaactgacggtgcaaaa
cgtgccttcatcgtgactgaccgctacctgttcaacaacggttatgccgatcaaatcacc
agcgtactgaaatctcacggtatcgaaactgaagtcttcttcgaagtagaagcagaccct
accctgagcatcgtacgtaaaggtgcagagcagatgaactccttcaaaccagacgtgatc
atcgcgctgggtggtggttcaccgatggatgctgccaaaatcatgtgggtgatgtacgaa
catcctgaaactcacttcgaagaactggcattgcgctttatggatatccgtaaacgtatt
tacaagttcccgaaaatgggcgtgaaagcgaaaatgatcgccgtcactaccacatcaggt
accggttcagaagtcacgccatttgccgtagttactgacgatgcgacaggccagaaatat
ccattggctgactatgcattgacaccagatatggcaatcgttgatgccaacctggttatg
aatatgcctaagtctctgtgtgccttcggtggactggacgcagtgacccatgctctggaa
gcgtatgtttctgtattggcaaacgaatactctgacggtcaggctctgcaagcgctgaaa
ctgctgaaagaattcctgccagccagttatcacgaaggggcaaaaaatccggttgcacgt
gaacgcgttcacaacgccgcgaccattgccggtatcgcttttgctaacgccttcttgggt
gtctgtcactcaatggcccataaactgggttctgagttccacatcccacacggcctggca
aacgccatgttgatttctaacgttatccgctataacgcgaatgacaacccaaccaaacag
actgctttcagccagtatgaccgcccacaagcgcgtcgtcgctatgctgaaattgcagac
catctgggtctgagtgctccgggcgaccgtaccgcacagaaaatccagaaattgctggct
tggttagatgaaatcaaagctgatttgggcatcccggcgtcaattcgtgaagctggcgtt
caagaagcagacttcctggctaaagtagacaaattgtctgaagatgcattcgatgaccag
tgtacaggtgctaacccacgctacccactgatctctgagctgaaacagatcctgatggat
acttactacggccgtgaatttagcgaagagcttgaccgtgaagaagttgcagtagcaact
tcagcaccaaaagctgagaaaaaagctaaaaagtaa

DBGET integrated database retrieval system