KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2262Help
Entry
YE2262            CDS       T00469                                 

Gene name
nam
Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    YE2262 (nam)
Enzymes [BR:yen01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     YE2262 (nam)
    3.5.1.-  
     YE2262 (nam)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2471842..2472495
Genome map
AA seq 217 aa AA seqDB search
MNAALLLIDLQNDFCPGGALAVAKGDAVIAVANEAITTCLAHKIPIIASQDWHPAEHRSF
AVNSQAEPWTTGDLEGLTQVWWPVHCVQNSVGAALHPKLNQEVITQIFRKGQNPDIDSYS
AFFDNGRRAKTPLDDWLQQQGINCLFVMGLATDYCVKYTVLAALTLGYKTSVIKDGCHGV
NLQPQDSQLALDAMNEAGANIQSLAQFIAEVKQLTAR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcagcgctgttgttaattgatttgcagaatgatttttgcccaggtggtgcgtta
gcggttgccaagggtgacgcggtgattgccgttgcaaatgaggctattactacctgtctg
gctcacaaaataccgattatcgccagccaggattggcacccagcagaacaccgcagtttt
gctgtcaattcgcaggcagagccttggacgaccggtgatttggaagggttaacccaagtg
tggtggccggtgcattgtgttcagaattcagttggagcagctttgcatccaaagttgaat
caagaggttattactcagattttccgtaaaggtcagaatccggatatcgacagctacagt
gcttttttcgacaatggacggcgggcaaaaacaccgctggatgattggttacaacaacaa
gggatcaattgcctgttcgttatgggattagcaacagattactgtgtgaaatacaccgtg
ttggctgcattaacattaggttataaaacatccgtcattaaggatgggtgccatggcgtc
aatttgcaaccacaagacagccaactggctcttgatgcgatgaatgaagccggagctaac
atacagtcattggcgcaatttattgctgaagtaaagcaactgacagctcgctga

DBGET integrated database retrieval system