KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2269Help
Entry
YE2269            CDS       T00469                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:yen00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2476274..2477152
Genome map
AA seq 292 aa AA seqDB search
MNEKVFTLPVVEQISPYISQRQLDELPIVVVSHPKVRAAVSLQGAHLLAFQPSGEQPIIW
LSNNTPFKDGVAIRGGVPICWPWFGPSAQPSHGFARLLPWQLSAHDENENGVILTFTLED
SDASRQFWPHPFTLIARFKLGEECEMELESHGEYEAVAALHTYFQIGDISQIKISGLGEK
YLDKVLKIADATQQGDLLFNGQTDRIYTHPEAYSLIKDAALKRTIEVHHHHQSDVVAWNP
GAELSSSMVDMPNDGYKTMVCVETARVNKPLVAKQDSPARLAMTIRSRKNAQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaagtcttcaccctacctgttgttgaacaaatttcaccttatatcagccag
cgccagttggatgaactgccaatcgtagtggtttcccatccgaaggtgcgtgccgccgtc
agcttgcaaggtgctcatttattggctttccaaccgagtggtgagcaaccgattatttgg
ttaagtaataacacaccatttaaagacggtgtcgctattcgtggtggtgtgccgatctgt
tggccttggtttggcccatcagcacaaccttcgcatggttttgctcgtttactgccatgg
cagctcagcgcccatgatgaaaatgagaatggggttatcttgaccttcactctggaagac
agcgatgcatctcgtcaattctggccacacccgttcactttgattgcccgcttcaagctg
ggcgaagaatgtgaaatggaattagaatcacacggtgagtacgaggcagttgctgccttg
cacacttatttccagattggtgatatcagccagattaagatcagtggcctgggcgaaaag
taccttgataaagtgctgaaaattgctgatgcaacgcaacaaggtgacttgctctttaac
ggtcagactgaccgcatctatacccaccctgaagcctacagcctgataaaagatgccgcg
ctgaaacgtaccattgaagtgcatcatcatcatcaaagtgacgtagttgcgtggaatcca
ggtgctgaactgtccagcagcatggttgatatgccaaatgatggctataaaacaatggtt
tgtgtagaaactgcgcgggtgaataaaccgttggttgccaagcaagattcccctgcacgt
ctggccatgaccattcgtagtcgcaagaatgcccaataa

DBGET integrated database retrieval system