KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2269Help
Entry
YE2269            CDS       T00469                                 

Definition
(RefSeq) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
yen00010  Glycolysis / Gluconeogenesis
yen01100  Metabolic pathways
yen01110  Biosynthesis of secondary metabolites
yen01120  Microbial metabolism in diverse environments
yen01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YE2269
Enzymes [BR:yen01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     YE2269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 4715382
NCBI-ProteinID: YP_001006497
UniProt: A1JQI5
Position
2476274..2477152
Genome map
AA seq 292 aa AA seqDB search
MNEKVFTLPVVEQISPYISQRQLDELPIVVVSHPKVRAAVSLQGAHLLAFQPSGEQPIIW
LSNNTPFKDGVAIRGGVPICWPWFGPSAQPSHGFARLLPWQLSAHDENENGVILTFTLED
SDASRQFWPHPFTLIARFKLGEECEMELESHGEYEAVAALHTYFQIGDISQIKISGLGEK
YLDKVLKIADATQQGDLLFNGQTDRIYTHPEAYSLIKDAALKRTIEVHHHHQSDVVAWNP
GAELSSSMVDMPNDGYKTMVCVETARVNKPLVAKQDSPARLAMTIRSRKNAQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaagtcttcaccctacctgttgttgaacaaatttcaccttatatcagccag
cgccagttggatgaactgccaatcgtagtggtttcccatccgaaggtgcgtgccgccgtc
agcttgcaaggtgctcatttattggctttccaaccgagtggtgagcaaccgattatttgg
ttaagtaataacacaccatttaaagacggtgtcgctattcgtggtggtgtgccgatctgt
tggccttggtttggcccatcagcacaaccttcgcatggttttgctcgtttactgccatgg
cagctcagcgcccatgatgaaaatgagaatggggttatcttgaccttcactctggaagac
agcgatgcatctcgtcaattctggccacacccgttcactttgattgcccgcttcaagctg
ggcgaagaatgtgaaatggaattagaatcacacggtgagtacgaggcagttgctgccttg
cacacttatttccagattggtgatatcagccagattaagatcagtggcctgggcgaaaag
taccttgataaagtgctgaaaattgctgatgcaacgcaacaaggtgacttgctctttaac
ggtcagactgaccgcatctatacccaccctgaagcctacagcctgataaaagatgccgcg
ctgaaacgtaccattgaagtgcatcatcatcatcaaagtgacgtagttgcgtggaatcca
ggtgctgaactgtccagcagcatggttgatatgccaaatgatggctataaaacaatggtt
tgtgtagaaactgcgcgggtgaataaaccgttggttgccaagcaagattcccctgcacgt
ctggccatgaccattcgtagtcgcaagaatgcccaataa

DBGET integrated database retrieval system