KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2393Help
Entry
YE2393            CDS       T00469                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:yen03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2582310..2582927)
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGIILEKQPPLVLLETNGVGYEVQLPMTCFYELPDIGQEAIIFTQFVVREDAQLL
YGFNDKQERALFRELIKVNGVGPKLALAILSGMSAQQFVAAVEREDITTLVKLPGVGKKT
AERLVVEMKDRFKGLNGDLFNNTGDIQLPASNSSQISDADIEAEAASALVALGYKPQEAS
RLVSKIAKPGADCETLIRDALRAAL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgatagggcgcctcagaggtatcattctggaaaaacagccacccttggtgctgctggaa
actaacggtgttggctatgaagtccaactacctatgacctgtttttatgagctgccagat
attgggcaggaagccattatctttacccagtttgtggtgcgcgaagatgctcagctacta
tacggttttaatgataagcaggaacgagcactgtttcgtgaattaataaaagtgaacggt
gtggggccaaaactggcgctggccattctttctggaatgtctgcgcaacagtttgtggcc
gcagttgaacgcgaagatattaccaccttggtgaaattaccgggggtcggcaagaagacc
gctgagcggttagtagttgaaatgaaagaccgatttaaaggcctcaatggtgacttgttt
aacaataccggtgatattcagttgcctgccagcaattcgtcacaaatctcagatgccgat
atcgaagcggaagccgcttctgcgctggtggctttgggctataaaccacaagaagctagc
cgtctggtgagtaaaatagctaaaccgggtgcagattgtgaaaccttgatccgtgatgct
ttgcgtgccgcgttatag

DBGET integrated database retrieval system