KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2434Help
Entry
YE2434            CDS       T00469                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:yen00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2624822..2625661
Genome map
AA seq 279 aa AA seqDB search
MNLFLYITGQRTDGYHLLQTLFQFLDYGDELTIVPRDDDQIRLLTPIVGVENEQNLIIRA
ARLLQQHPSSAKVPRGADISIDKRLPMGGGLGGGSSNAATVLVALNTLWHCGLSDEELAA
LGLTLGADVPVFVRGHAAFAEGIGEKLHPAEPIEKWYLVVHPGVNIPTPIIFSDPELKRN
TPIRPLAALLSAPYANDCEPIARKRFREVEQALSWLLEYAPSRLTGTGACVFAEFDTESS
ARQVLSIAPEWLHGFVARGVNLSPLHRVRSGKMENSEHR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
ttgaatttgtttctttatatcaccgggcaacgcactgatggctatcacctattacagact
ttgttccagtttctcgattatggcgatgaactgacgattgtgccccgcgatgacgatcaa
attcgactattaactcccattgtcggagtggaaaacgaacaaaacctgataatccgcgcg
gcacgattgctgcaacaacatcccagctcagcaaaagtacctcggggggcggatattagc
atcgataaacgcttgccaatggggggcggtttgggtggcggttcgtccaatgcagcaacg
gtgctagtcgcactcaataccctgtggcactgtggtctgtctgatgaagaattagccgct
cttggactcacattgggggccgatgtaccggtatttgttcgcggtcatgccgcctttgcc
gagggaattggtgaaaagttgcaccccgcagagcctatagagaagtggtatttggtggtt
caccccggagtaaacatcccaacgcccattattttttccgatcctgaattaaaaagaaat
acgccaattcgcccactggcggcgcttttaagcgctccgtacgcaaatgattgcgaacca
atcgcaagaaaacgttttcgcgaggttgaacaggctctttcatggctgttagaatatgcc
ccgtcacgcctgaccggaaccggagcttgtgtctttgcagaatttgacacggagtcatcg
gcccggcaggtgttaagtattgccccggagtggttgcacggttttgttgcccgtggagtg
aacctttcgccactgcatcgcgtacgctctgggaaaatggaaaacagtgagcacagataa

DBGET integrated database retrieval system